SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087V6M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087V6M8
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily BEACH domain 4.71e-117
Family BEACH domain 0.000000000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087V6M8
Sequence length 260
Comment (tr|A0A087V6M8|A0A087V6M8_BALRE) Lipopolysaccharide-responsive and beige-like anchor protein {ECO:0000313|EMBL:KFO08270.1} KW=Complete proteome; Reference proteome OX=100784 OS=Balearica regulorum gibbericeps (East African grey crowned-crane). GN=N312_04499 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Gruidae; Balearica.
Sequence
MTQRWQHREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVITNYESEELDLTLPSNFRDLS
KPIGALNPKRAAFFAERYESWEDDQVPKFHYGTHYSTASFALTWLLRIEPFTTLFLNLQG
GKFDHADRTFSSISRAWRNSQRDTSDIKELIPEFYYLPEIFVNSNNYNLGVMDDGTVVSD
VELPPWAKTPEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAVRSLNVFYYLTYE
GAVNLSSITDPVLREVSLYF
Download sequence
Identical sequences A0A087V6M8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]