SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087VAW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087VAW2
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 3.4e-52
Family Bcl-2 inhibitors of programmed cell death 0.0000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087VAW2
Sequence length 182
Comment (tr|A0A087VAW2|A0A087VAW2_BALRE) BH3-interacting domain death agonist {ECO:0000313|EMBL:KFO09754.1} KW=Complete proteome; Reference proteome OX=100784 OS=Balearica regulorum gibbericeps (East African grey crowned-crane). GN=N312_13311 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Gruidae; Balearica.
Sequence
NGSVRMERALLYTFLEVSSDCKFREQLQSLQSQGGVFFPRYCYDDEVELQTDGNRSGHLQ
NGELVFDPEVNEEVVRIIAAQLAEIGDQFDKEIKARVVNDLVQHFLNENLSGEEITRRMS
EAVEGLARAIPSDMEQEKAMLVLAMVLTKKIANTMPSLLQRVFSTTVNYISQQLHNYIVR
MV
Download sequence
Identical sequences A0A087VAW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]