SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087VM83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087VM83
Domain Number 1 Region: 15-41
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000353
Family Ran binding protein zinc finger-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087VM83
Sequence length 221
Comment (tr|A0A087VM83|A0A087VM83_BALRE) RING1 and YY1-binding protein {ECO:0000313|EMBL:KFO13725.1} KW=Complete proteome; Reference proteome OX=100784 OS=Balearica regulorum gibbericeps (East African grey crowned-crane). GN=N312_11835 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Gruidae; Balearica.
Sequence
PSSRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVA
QQYATPPPPKKEKKEKAEKQDKEKPDKEKEISPSVTKKNANKKTKPKSDIVKDPPSEANS
IQSGNTTTKTSDSNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTV
TSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF
Download sequence
Identical sequences A0A087VM83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]