SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087VQE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087VQE3
Domain Number 1 Region: 182-380
Classification Level Classification E-value
Superfamily MIR domain 3.49e-64
Family MIR domain 0.0000000635
Further Details:      
 
Domain Number 2 Region: 382-547
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.22e-56
Family IP3 receptor type 1 binding core, domain 2 0.000000227
Further Details:      
 
Domain Number 3 Region: 1106-1227
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.23e-32
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 52-165
Classification Level Classification E-value
Superfamily MIR domain 3.14e-21
Family MIR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087VQE3
Sequence length 1637
Comment (tr|A0A087VQE3|A0A087VQE3_BALRE) Inositol 1,4,5-trisphosphate receptor type 2 {ECO:0000313|EMBL:KFO14835.1} KW=Complete proteome; Reference proteome OX=100784 OS=Balearica regulorum gibbericeps (East African grey crowned-crane). GN=N312_09773 OC=Coelurosauria; Aves; Neognathae; Gruiformes; Gruidae; Balearica.
Sequence
DCLFKVCPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENRKLLGEI
VKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIQPFWKLRSEGD
NVVVGDKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKFSSYRDDVL
KGGDVVRLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRG
GAGQWNSLFRFKHLATGNYLAAELNPHYPEGNNEGKALRDGNLPASKKKRQAGEKIMYTL
VSVPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVM
LKIGTCQTKEDKEAFAIVSVPLSEVRDLDFANDANKVLASTVKKLENGTITQNERRFVTK
LLEDLIFFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQIFGILRAPFKDKGEGSM
LRLEDLGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTI
TALLHNNRKLLEKHITAKEIETFVNLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKF
MLSPGNADILIQTKLVSTQMDNPLECPVISDDIDEEEVWLYWIDSNKEPHGKAIRHLAQE
AKEGTKADLEVLTYYRYQLNLFARMCLDRQYLAINQISAQLSVDLILRCMSDESLPYDLR
ASFCRLMLHMHVDRDPQETVVPVKYARLWTEIPTKITIHEYDSFTDSSRNEMKRKFALTM
EFVEEYLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDI
VQVPISSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPISAPDVQPSIHPSKQ
ASTSDSEDVIVMDTKLKIIEILQFILSVRLDYRISYMLSIYKREFGENNENVDSSTTSPP
DTPGTASAIVPDIDEIAAQAETMFAGRKEKNAVQLDDEGGRTFLRVLVHLIMHDYPPLLS
GALHLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSS
SYESGEVGDNQTKGGEEPIEESNILSPIQDGTKKPQIDSNKSNNYTIVKEILIRLSKLCV
QNKKCRNQQQRLLKNMGAHLVVLDLLQIPYEKSDEKMNEVMNLAHTFLQNFCRGNPQNQV
LLHKNLNLFLTPGLLEAETMRHIFMNNYLLCNEISERVVQHFVHCIETHGRHVEYLRFLQ
TIVKADGKYVKKCQDMVMTELINGGEDVLIFYNDRASFPVLLQMMCSERDRADESGPLAY
HITLVELLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDT
EVEMKEIYASNHIWNLFENFLVDMARVCNTTTDRKHADTSLEKYVTEPVMNIVSGFFNSP
FSDNSTSLQTHQPVFIQLLQSAFRIYNCTWPNPTQKASVESCIKTLAEVAKNRGIAIPVD
LDSQVNTLFMKSHSNMVQRAAMGWRMSARSGPRFKEALGGPAWDYRNIIEKLQDVVSSLE
QQFTPMMQAEFSVLVDVLHSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKI
LQTLREMLDKKTNFAEE
Download sequence
Identical sequences A0A087VQE3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]