SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087WR04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WR04
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily LEM domain 1.08e-16
Family LEM domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087WR04
Sequence length 69
Comment (tr|A0A087WR04|A0A087WR04_MOUSE) MCG129508, isoform CRA_b {ECO:0000313|EMBL:EDL39684.1} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_129508 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MVDVKCLSDYELHKHLMKLGFTPGPILPSTRKTYEKKLVQLLASPPWKPPVMKRPTRPHG
SEDSDDSEV
Download sequence
Identical sequences A0A087WR04
ENSMUSP00000140418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]