SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087WSF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087WSF1
Domain Number 1 Region: 24-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087WSF1
Sequence length 143
Comment (tr|A0A087WSF1|A0A087WSF1_MOUSE) Zinc finger protein 383 {ECO:0000313|Ensembl:ENSMUSP00000141019} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Zfp383 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSAPLLQRYPVEKRGMAVDHAKNKKPVVFSDVSLDFSQEEWECLGPAQRDLYKDVMLENY
SNLLSVGKDTCISSAAISAVSASSSRNFSAAFQACHLNSCSLFANTWFQLGGNRSLRDRR
LRWAVAKASSSSLAVPVLTSLAW
Download sequence
Identical sequences A0A087WSF1
ENSMUSP00000141019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]