SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XCJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XCJ4
Domain Number 1 Region: 4-162
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 9.16e-45
Family TRAPP components 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087XCJ4
Sequence length 163
Comment (tr|A0A087XCJ4|A0A087XCJ4_POEFO) Trafficking protein particle complex 6b-like {ECO:0000313|Ensembl:ENSPFOP00000003497} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MADDSLFEFLHMEIVSHIFNEQQSRKGELDNKDRAACISLLEAMGFRVGQGLIERLTRDT
PSFKDELDIMKFICKDFWTKVFRRQVDNLRTNHQGTYVLQDNKFSLLTQFSGGKQYLDQA
PKYLAFSCGVVRGALSNLGLESVVTAEVSIMPSCKFQVVIQKL
Download sequence
Identical sequences A0A087XCJ4
XP_007563105.1.10163 XP_014850958.1.96476 ENSPFOP00000003497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]