SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087XJU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XJU3
Domain Number 1 Region: 86-251
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.84e-59
Family IP3 receptor type 1 binding core, domain 2 0.0000000475
Further Details:      
 
Domain Number 2 Region: 774-931
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 7.06e-36
Family IP3 receptor type 1 binding core, domain 2 0.0073
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily MIR domain 1.96e-19
Family MIR domain 0.00000946
Further Details:      
 
Domain Number 4 Region: 883-991,1069-1343,1622-1804
Classification Level Classification E-value
Superfamily ARM repeat 0.00000288
Family PBS lyase HEAT-like repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087XJU3
Sequence length 2426
Comment (tr|A0A087XJU3|A0A087XJU3_POEFO) Inositol 1,4,5-trisphosphate receptor, type 1b {ECO:0000313|Ensembl:ENSPFOP00000006046} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MYTLVPVPDGMEVSSIFELDPTTLRGGDSMVPRSSYVRLRHLCTNTWVHSTNLPIDKEEE
KPVMLRIGTSAVKEDKEAFAIVPVPPSEVRDLDFANDASKVLASIAGKLEKGTITQNERR
FVTKLLEDLVFFVVDIPNSGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPFTDSG
DGPMLRLEELGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFRFMQKQIGYDVLA
EDTITALLHNNRKLLEKHITAAEIDTFVTLVRKNREPRFLDYLSDLCVSMHKSIPVTQEL
ICNAVLDSSNADILIETKLVLSRFEIESTANGEDPVEPEEVEEVWLFWKDNCKEVRSKSV
RELAQDAKEGQKEDQEVVSYYRCQLNLFARMCLDRQYLAINKISGQLDVDLILRCMSDED
LPFDLRASFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSKIAIDDYDNDGTTRDEIKER
FSLTMDFVETYLREVVSQNIPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILL
NILDCVHVSTVFPINKIEKGDESKGGSNVMKSIHGVGELMTQVVLRGGGLLPATPTHQPE
GDVVKTQTEPEREDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNPQGDN
AVSANGGNNITPQMPGNLDFENIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMH
DYPPLVSGALHLLFRHFSQRQEVLMAFKQVQLLVTSQDVENYKQIKSDLDQLRSIVEKSE
LWVYKRQGEDGMDGDGPSESDSKKKGDSPGSDKKKSESTSSYNYRVVKEILVRLSKLCVQ
EGISGKKSKKQQQRLLRNMGAHSVVLELLQIPYEKGEDVRMQDIMKLAHEFLQNFCAGNQ
QNQTLLHKHINLFLNPGILEAVTMQHIFMNNSQLCNEINERVVQHFVHCTETHGRHVQYL
KFLQTIVKADNKFIKKCQDIVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERERLDENS
PLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHC
YVDTEVEMKEIYTSNHMWKLFENFLVDICRVCNNTSDRKHADTILERYVTETVMSIVTCF
FSSPFSDQSTSLQMARHMYTRQPVFVQLLQGVFRVYHCNWLNPAQKHSVEGCIKVLSDVA
KSRAIAIPVDLDSQVNNLFVKPNNVVQKTLLNWKQSAKNTSRRESSLCASKDYRNIIEKL
QDIVSALEDRLRPLVQAELSVLVDVLHRPELLFPENTDARKKCESGGFISKLIKHTKQLL
EENEERLCIKVLQTLREMMTKDRGYGVKLIAFDDEMDVAELAPPPEPEVPAEELDPNQPL
KQVEDQRRGEALRLILVNRYYGNIKPGQRRESLTSYSNGPLTPGAQGKSPTLVSAGIGGR
GELSLAEVQCHLDKEGASDLVIDLIMNATSDRIFQESILLAIALLEGGNTVIQRSFYNRL
TGDNKSEKFFKVFYERMKLAQQEIKATVTVNTSDLGSKKKDEEPPDKDMPTRKKVKDVPV
VAMVTEEVKEQLVEASAVTKKAYATYRREAEAEEHQAAAADGAPVPTTDKSQDEGEMSVI
ITIMQPILRLMQLLCENHNRDLQNFLRNQNNKNNYNLVCETLQFLDCICGSTTGGLGLLG
LYINEKNVGLINQTVESLTEYCQGPCHENQNCIATHECNGIDIIIALILNDINPLGKKRM
DLVLELKNNASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEIEVEEPEEG
EDGEEEHSASPRNVGHNIYILAHQLARHNKELQAMLKPGGTYGEGDEALEFYAKHTAQIE
IVRLDRTMEQIVFPVPNICEFLTQESKLRVYYTTERDEQGSKINDFFLRSEDLFNEMNWQ
KKLRGTQEATGNTNTVPSQPILYWCSRNMSFWSSISFNLAVLMNLLVAFFYPLEGVRGGT
LEPHLSALLWMAMLVSLAIVIVLPQPHGIRALIASTILRLIFSVGLEPTLLLLGGFNLCN
KVIFLMSFVGNRGTFTRGYKAMIMDVEFLYHLLYLIICSLGVFVHVFFYSLLLFDLVYRE
ETLLNVIKSVTRNGRSIVLTAVLALILVYLFSIVGYIFFKDDFILAVDRIPNKTLEHGAS
MIGEFFSGGACQKENGENCSTEAVMDAAVAVQPSVVIEDKERTCDSLLMCIVTVLSHGLR
SGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKE
EILKTTCFICGLERDKFDNKTVTFEEHIKVEHNMWHYLFFIVLVKVKDSTEFTGPESYVA
EMIREHNLDWFPRMRAMSLVSSDADGEQNEIRNLQEKLESTMKLVTNLSGQLTELKEQMT
EQRKQKQRIGLLGHPQHLNVNPQQPA
Download sequence
Identical sequences A0A087XJU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]