SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087XPK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XPK2
Domain Number 1 Region: 172-371
Classification Level Classification E-value
Superfamily MIR domain 4.45e-65
Family MIR domain 0.00000000959
Further Details:      
 
Domain Number 2 Region: 373-538
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.83e-58
Family IP3 receptor type 1 binding core, domain 2 0.0000000535
Further Details:      
 
Domain Number 3 Region: 1059-1218
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 3.53e-32
Family IP3 receptor type 1 binding core, domain 2 0.0094
Further Details:      
 
Domain Number 4 Region: 44-155
Classification Level Classification E-value
Superfamily MIR domain 1.57e-18
Family MIR domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087XPK2
Sequence length 2693
Comment (tr|A0A087XPK2|A0A087XPK2_POEFO) Inositol 1,4,5-trisphosphate receptor, type 1a {ECO:0000313|Ensembl:ENSPFOP00000007705} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MNRYSAQKQFWKAAKPGGNTDTVLLNKLHHAADLEKKQNDSENKKLLGTVIQYGNVIQLL
HLKSNKYLTVNKRLPALLEKNAMRVMLDTAGNEGSWFYIQPFYKLRSIGDSVVIGDKVVL
NPVNAGQPLHASTHQLGDNPGCNEVNSVNCSTSWKIVLFMKWSDNQERVLKGGDVVRLFH
AEQEKFLTCDDHRKKQYVFLRTTGRQSATSATSSKALWEIEVVQHDPCRGGAGYWNSLFR
FKHLATGHYLAAEVNPEYEEEGLDFRSPLDSEQDPLRARLKTVPDKVVYTLISVPHGNDI
SSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNQPIDKEEEKPVMLRIGTSPHK
EDKEAFAIVPVSPAEVRDLDFANDASKVLASIAGKLEKGTITQNERRAVTKLLEDLVFFV
VDIPNNGQDVLEIMVNKPNRERQKLMREQNILKQIFKLLQAPFTDGGNGPMLRLEELADQ
RHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFRFMQKQIGYDVLAEDTITALLHNNRK
LLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICTAVLDPANADI
LIETKLVLSRFEIEGSQLGENSVEVEEDEEEVWLFWNNSDKEMRSKSVREMAQDAKDGQK
EDKEVISYYRYQLNLFARMCLDRQYLAINKISVQLDVDLILRCMSDEDLPFDLRASFCRL
MLHMHVDRDPQEQVTPVKYARLWSEIPSKISINDYDNDGTTKDNIKERFWQTMEFVENYL
RDVVCQNVPFADKEKNKLTSEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVSNVF
PFTKLEKGDGGRGSNVMRSIHGVGELMSQVVLRGGGFLPINTNSGPNDDTVKAQIEPEKQ
DILVMDTKLKIIEILQFILNVRLDYRISCLLSIFKREFDESTSQNELSISGSVEGPNNIP
GALDFENIEEQAEAIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHEYPPLVSRALHLLFR
HFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKEDLDKLRSIVEKSELWVYKRQGPDEGLDG
GEGMPAEPEPQKGAVATDKPRKAESVSSKNYRVIKEVLLRLSRLCIQEGLSGRKSRKQQQ
RLLRNMGAHAVVLELLQIPYEKGEDVRMQDNMKLAHQFLQNFCAGNQQNQALLHKHINLF
LNPGILEAVTMQHIFMNNFQLCSEINDRVVQHFVHCIETHGRNVQYLKFLQTIVKAENKF
IKKCQDIVMAELVNAGEDVLVFYNDRASFQTLVSMMQSERDRMDENSPLRYHIHLVELLA
VCTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEIKIAYINFLNHCYVDTEVEMKEIYT
SNHMWNLFDNFLVDICRVCNNTSERKHADNVLERYVTETVMSIVTTFFSSPFSDQSTSLQ
DVRLRKSLQTRQPVFVQLLQAVFRVYHCYWLGSGQKGSVETCIKVLSDVAKSRAIAIPVD
LDNQVNNLFVRANNIVQRTAISWRLSVRNSHLSARRESVVTVSRDYRNIIERLQDIVSAL
EDRLRPLVQAELSVLVDVLHRPELLFPENTDSRKKCESGGFICKLIKHTKQLLEENEEKL
CIKVLQTLREMMTKDRGYGEKLRAFDDEMEMPKKLDQNVPPKLLADQRRGEALRQILVSR
YYGNFHRSSGRRDSLTSFGNGPLSPVGPGRSQSALGGPGGLSRGEMTLSEVQCHLDKEGA
SDLVIDLIMNTTSDRVFQESILLAIALLEGGNTTIQRSFFCRLTDDKNSEKFFRVFYDRM
KSAQQEIKATVTVNTSDLGNKRRDEDYQYIDDPLRKRARESPVSSMTEDAKEQLIEASSA
TKKAFNSYRREAEPEDHCSSTDGLPSAGAKNQEEKMSFVVVIMQPILRFLQLLCENHNRD
LQNFLRNQNKKNNYNLVCETLQFLDCICGSTTGGLGLLGLYINEDNVALINQTLESLTEY
CQGPCHENQNCIATHESNGIDIIIALILNDINPLGKKRMDLVLELKNNASKLLLAIMESR
HDSENAERILYNMKPKELVEVIKKAYLQGEEEYENIKEEEDVRDEEEHDAASPRNVGHNI
YILAHQLARHNKELSMMLKPGGGTEDGDEALEFYAKHTAQIEIVRQDRTMEEIVFPVPNI
CEFLTSESKLRIYYTTERDEQGSKINDFFLRAEDLFNEMNWQKKLRAEPVLYWCSRNMSV
WSNISFKLALLMNLLVCFFYPLEGVHGGILEPHLSALLWMGFFAALVLVLLMPKPLGILA
LVAVTILRLIFSVGLEPTLFLLGAFNVCNKIIFLISFVGNRGTFTRGYKAMVMDFEFLYH
LLYLIICCLGVFGHVFFYSLLLFDLVYREETLLNVIKSVTRNGRSIVLTAVLALILVYLF
SIVGYIFFKDDFILEVDRIANATQKSGGSLAGEFLNTGMCQGGLNENCSNIVQQEEFGID
TEDENNMERTCDSLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMV
IIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHN
MWHYLYFIVLVKVKDSTEYTGPESYVAEMIKEHNLDWFPRMRAMSLVSSDSEGEQNEIRS
LQEKLESTMRLVINLSGQLTELKEQMTEQRKQKQRMGLLGHPPHLNINPQQPA
Download sequence
Identical sequences A0A087XPK2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]