SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087Y2Z5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087Y2Z5
Domain Number 1 Region: 238-435
Classification Level Classification E-value
Superfamily MIR domain 5.84e-62
Family MIR domain 0.0000000922
Further Details:      
 
Domain Number 2 Region: 437-604
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 6.67e-53
Family IP3 receptor type 1 binding core, domain 2 0.000000372
Further Details:      
 
Domain Number 3 Region: 1124-1271
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 6.67e-34
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 111-220
Classification Level Classification E-value
Superfamily MIR domain 1.16e-18
Family MIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087Y2Z5
Sequence length 1517
Comment (tr|A0A087Y2Z5|A0A087Y2Z5_POEFO) Inositol 1,4,5-trisphosphate receptor, type 3 {ECO:0000313|Ensembl:ENSPFOP00000012398} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MSDSASSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLENPPKKFRDCLFKV
CPMSRYSAQKQYWKAKQAKHEKDKIADVVLLQKLQHASNLEQKQNETENRKVHGDVVKYG
TVIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDGTGNEGSWLFIQPFWKLRANGDNVVV
GDKVIMNPVNAGQPLHASNYELSDHPGCKEVNSVNCNTSWKINLFMMFNDHREEVLKGGD
VVRLFHAEQEKFLTCDEYKSKLHVFLRTTLRQSATSATSSNALWEVVRQVVHHDPCRGGA
GHWNSLYRFKHLATGNYLAAEENPGYKGDNPELSSSMDASRSSKRFHGERIKYKLVVVPH
GNDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIDEERPIRLMLGT
CPTKEDKEAFAIVSVPVMEIRDLDFANDASAMLATVVDQFNSGFISQNDRRFAIKLLEDL
VFFVADVANSGQSVLDVVMSKPNRERQKLMREQNILKQIFGILKAPFKDRGEDEGPLLRL
EELADQKNAPYQYMLRLCYRVLRHSQEDYRKNQEHIAKQFGVMQSQIGYDILAEDTITAL
LHNNRKLLEKHITKTEVETFVSLVRKNREPRRFLDYLSDLCVSNNVAIPVTQELICKCVL
DPKNQDILIKTDFIYQIDMLDGEFLGMDEFGDEDEVWLMWTDKTNEKQDKSIRQLAQEAR
QGNAHDENVLTYYRYQLKLFARMCLDRQYLAIDEISKQLDVELIFLCMMDETLPFDLRAS
FCRLMLHAHVDRDPQELVTPVKFARLWAEIPTSITIKDYDSNLDDSRDNKKNRFANTMVF
MEEYLNNVLNDELPFHDEEKNKLTYEVVSLARHLIYFGFYSFFELLRLTRTLLGIIDCKP
NSLLTSIAFQEESSXGGRNVRRTIHGMGQMMTTMVLNRRQSTFSGAGPRGPGFVMEAQRG
SKDSIDNLDLTVMDTKLKILEILQFILNVRLDYRLSFLLSVFKKEFLDVYPMAEADATTN
VEQAAAVNLQQIGDQAEAMFGVGKMNSVLEVDDEGGRMFLRVLIHLTMHNYAPLVSGALQ
LLFRHFSQRQEVLHTFKQVQLLISTLDVENYKLIKADLDRLRTLVEKSELWVEKKSSGGG
DGKKDKKEKVEGASEDPSPKKEKLQKGNENYQNVKEILERLNKMCSSGVWKKQQRLLKNM
GAHKVMLDLLQVSYDKNDVKMQEIIKYTHMFLQKFCMGNQENQALLHKNLNLFLNPGLQE
AETVQHIFSNNYQLCSEISESVLQHFIHCLATHGRHVQYLNFLHTIIKAEGKYVKKCQDM
IMTELTNAGEDVVVFYNDKASFTTMLELMAESREGVRDNSPLRYHISLVELLAACAEGKN
VYTEIKCTSLLPLEDVVRVVTHEDCITEVKIAYVNFVNHCYVDTEVEMKEIYTSNHIWKL
FEDFTVDMARVCNKREKRLTDPVLEKYIINVVFDTITAFFSSPFSENSTSLQTHHTIVVQ
LLQSSIRLLDCPWLLPL
Download sequence
Identical sequences A0A087Y2Z5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]