SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087Y437 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087Y437
Domain Number 1 Region: 219-396
Classification Level Classification E-value
Superfamily MIR domain 7.19e-47
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1074-1166
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000237
Family SPRY domain 0.074
Further Details:      
 
Domain Number 3 Region: 642-796
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000364
Family SPRY domain 0.058
Further Details:      
 
Domain Number 4 Region: 3907-3985
Classification Level Classification E-value
Superfamily EF-hand 0.000000818
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 5 Region: 1323-1445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000739
Family SPRY domain 0.02
Further Details:      
 
Domain Number 6 Region: 2054-2119
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000262
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 
Domain Number 7 Region: 102-184
Classification Level Classification E-value
Superfamily MIR domain 0.0000405
Family MIR domain 0.027
Further Details:      
 
Domain Number 8 Region: 425-542
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000471
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087Y437
Sequence length 4867
Comment (tr|A0A087Y437|A0A087Y437_POEFO) Ryanodine receptor 3 {ECO:0000313|Ensembl:ENSPFOP00000012790} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN=RYR3 OC=Poeciliinae; Poecilia.
Sequence
MFVFGLGKPRIIAFCRNDDEVVLQCVACIQKENHKFCLAAEGLGNRLCYLEPTSEAKYVP
PDLCICTFVLEQSLSVRALQEMLAKSGQNSEGAAHSGGHKTLLYGHAILLRHSFSSMYLA
CLKTSRSQTDKLSFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERY
LHLSISNGNIQVDASFMQTLWNVHPICSGSNIEEGYLLGGHVMRLFHGHDEVVSIPGSDQ
SEEQQRIVNYETGKAGAKARSLWRLEPLRISWSGSHIRWGQPFRLRHLTTGHYLALTEDR
GLVLQDRERSDTISTAFCFRASKEKLEQSPKRDIEGMGVAEIKYGDSVCFIMHVATGLWL
SYQAPDVKSTRLGPLKRRACLHSEGHMDDGLTLQRCQHEESRAARIIRNTTLLFNRFISV
KNRTLSALPVEEVLQTLNDLITYFQLPDVELEHEERQIKLRSLKNRQNLFKQEGMLTLVS
NCIDRLNVYNSAAHFGECAGSEAGAAWKDILNLLYELLAALIRGNRNNCTQFSNNLDWLV
SKLERLESSSGILEVLHCILIESPEALNIIQKGHIKSIISLLYKHGRNHKILDVLCSLCV
CNGVAVRTNQNLICDHLLPKRDLLLQTQLVNDVQSMRPNIFLGVSEGSAQYKKWYYELMI
DQVDHFVTSEPSHLRVGWANTKGYAPYPGGGEGWGGNGVGDDLYSFGFDGLHLWSGRIPR
AVASLNQHILTSEDVVSCCLDLGAPSISFRINGQPVQGMFENFNTDGLFFPVVSFSAGVK
VRFLLGGRHGDFKFLPPSSYAPCYEALLPKEKMKVEPVKEYKRDVEGVRDLLGTTQFTSQ
ASFIPTPVETSQVVMPPHLEKVRDKLAENIHELWGMNKIELGWTYGKIRDDNKRQHPCLV
DFSKLPETEKNYNLQMSTETLNQRTLLALGCRIVQVNPNAEDSLKKIKLPKNYMMSNSYK
PSPLDLSDIKLTPGQELLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSKRNPRLVPYVL
LDERTKKSNRDSLREAIRTMIGYGYNIEPSDQEGGQVAERVSVDKVRFFRVERTYAVKTG
KWYFEFEAVTGGDMRVGWARPGCKPDVELGTDKLAFVFDGYRGHCLNIGSRLFGRCWHAG
DVVGCMINMEDKSMIFTLNGEILITTKGSELCFTDFETEDGFIPVCSLGLAQVGRMNLGK
DASTFKYYTTCGLQEGFEPFAVNMNREVTMWFSKRLPTFVNVPKDHNHIAVTRIDGTIDS
PPCLKVTHKTFGTQNSNADMVFCRLSMPVEFHSFFKQSPTVDINGIHEEDLLKDIVLHMY
QQYYHSVRIFAGQDPSGVWVGWVTPDYHYYSNNFNLSKNRTVTVTLGDERGRVHNSVKRS
NCYMVWGGDMTSGAHASSRSNVDLDIGCLIDLSTGMVTFTVNGKELSTSYQVEPNTKLFP
AVFVRPTSPNLFQFELAKIKNAMPLSSAIFKSEHKNPVPQCPPRLDVQTINAVLWSRMPN
IFLKVETARVNERHGWVVQCVEPLQMLAVHIPEENRCVDIMELSEQEDMRKFHYHTLKLY
CALCALGNTRVAHALCSHLDQSQLLYTIDNQYLSGMLREGFYNVLISIHLETAKEARLMM
KDEFIIPVTAETRSIRLFSSASKKHSPPGVGLSTSLKPRLNFTPPCFISTKRDYLYSPQI
PLDALKEKAISMLTEAVQGGGHHIRDPVGGGVEYQFVPILKLISTLLTMGVLGSEDVQKI
LLLIDPNVFKDTREEGVPGPTDKEGLTGTEGKAVEAGEEEAAEEAKQPMKGLLEKRLPEP
VKRLMCELLHYFCDCELKHRIEAIVSFSDSFVSKLQYNQKFRYNELMLALNMSAAVTAKK
TKEFRSPPQEQINMLLTFSMGDDCPCPSEIQEELYDFHNQLQLHCGIPMEEDEDEKDTSI
KGRLLMLVNKIKSQSYKAQEPTEKKQAAPSNLKELISQTMVSWAQECHIQDPKLVRKMFS
LLRRQYDSIGELLRAMRKTYTISAASVQDTIHLLASLGQIRSLLSVRMGKEEEKLMIDGL
SDIMNNKVFYQHPNLMRILGMHETVMEVMVNVLGGDKSQEIAFPKMVASCCRFLCYFCRI
SRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAASSVMDNNGLALALEEPDLDKVV
TYLAGCGLQSCPMLLAKGYPDIGWNPIEGERYLSFLRFAVFVNGESVEENSSVVVKLLIR
RPECFGPALRGEGGNGLLAAMKEAIKISETPALDLPGSVHRVSSDLSADGDDEEEVVHMG
NAIMSFYSALIDLLGRCAPEMHLINKGKGEALRIRAILRSLVPTEDLVGIISIPLKTPIL
NKDGSMTEPDMSASFCPDHKAPMVLFLDRVYGIEDQSFLLHLLEVGFLPDLRTATTLDTE
GLCTTETALAMNRYIGSAMLPLLTRCAPLFAGTEHYATLIDSTLHTIYRLSKGRSLTKAQ
RDAIEECLLSICKHLRPSMLQQLLHRLVFDVPLLTEYCKMPLRLLTNHYEQNWKYYCLPS
GWGSFGTASEDELLLTKRIFWGVFDSLSQRKYDPELFKMAMPCLSAIAGALPPDYVDASI
CTAVEKPVSVDAQGNFDPKPINTANIVLPEKLEHLTNKYAEHCHEKWSAEKVLLGWKYGD
GVDEKAKTHPQLRIYKALTEKEKEIYRLPIRDSLKCMLAMGWSIDRTKDGESMSLQRENE
KMRKISQASQANGFNPSPVDTSNVTLSRELQGMVEVMAENYHNIWAKKKKSDLGSRGGGT
HPLLVPYDTLTAKEKARNREKALDLFRFLQINGYSITRGLKDLEQDSSSMEKRFAYKFLK
KLLKYVDSAQDFIAHLESMAASGKTDRSPHEQEIKFFAKVLLPLIDQYFKNHSLYFLSSP
NKNLSCSGYASNKEKEMVTSLFCKLAALVRHRISLFGSDSTTMVSCLHILAHTLDTRTVM
KSGSEQVRVGLRTFFENAAEDLEKTFENLKLGKFTHSRSQMKGVSQNINYTTVALLPILT
ALFEHITQHHFGVDLLLDDVQVSCYRILTSLFALGTGKNIYVERQLPALGQCLATLAGAM
PVAFLEPKLNTHNPCSVFNTKSARDRAVLGIRESVEEMCPGMPRLDGLMKDINDMAESGA
RYTEMPHVIEVVLPMLCNYLSYWWERGPENQAASGGSSYCTTVTSEHLSLILGNILKILN
NNLGIDEASWMKRIAVYVQPIISKARADLLKSHFLPTLEKLKKKTVKVVAEEELLKADSK
GDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRLNKSRWLKEPDSDSNELFRMVAEI
FILWCKSHNFKREEQNFVVQNEINNLSFLTGDNKTKMSKSFKEKSGGQDQERKHKKRRGE
FYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKTRYLMKDTDEEVKDHIHQNLHLRE
KSEDPAVRWQLNLYKDIVMRIESPPDPERVVDRIQRISAAIFNLEQVEQPLRSKKCVWQK
LLSKQRKRAVVACFRMAPLYNLPRHRSINLFLLAYQSIWIETEEYSFEEKLVQDLAKTQP
KVEEEEEEEVRKQPDPLHQLILHFSHNALTECSSLEEDPLYIAYADMMAKSCAEGEEEEE
GKEKTFEEKEMEKQKMLYQQARLHDRGAAEMVLQMISASKGRLGATVTFTLKLGISILNG
GNILVQQKMLDYLKEKRDVGFFKSLSGLMMSCSVLDLNAFERQNKAEGLGMVTEEGSINV
SERGSKVLQNDEFTKDLFRFLQLLCEGHNNDFQNFLRTQTGNTTTVNIIISTVDYLLRLQ
ESISDFYWYYSGKDVIDEAGQRNFSKALSVAKQVFNSLTEYIQGPCIGNQQSLAHSRLWD
AVVGFLHVFANMQMKLSQDSSQIELLKELLDLQQDMIVMMLSLLEGNVVNGTIGKQMVDT
LVESSSNVEMILKFFDMFLKLKDLTTSDSFREYDSESKGVISKKDFQKSMENQKQYSQSE
IEFLLSCAEADENDMFSYKQFVERFHEPAKDIGFNVAVLLTNLSEHMPHDARLSTFLNLA
ESVLSYFEPFLGRIEIMGGAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGE
SEKMELFVNFCEDTIFEMQLASQISEPDPVERSDEDEDESQNVVENQDEKEEENVMMESS
SAFTIACISMRKNLCHFRQLLTLKSMRRQYRRFRKMSVREMVKGFFSFFWMIITGLFHFI
YSLVWGFFHILWTTMFGGGLVEGAKNMKVTDILGNMPDPTQFGIHGDVLETEKMEANDAS
ALEEMGQMAQGDAAETDLMAELLNIQPRREGKHGTEPGLGDVSEVVVGDAPSIASAVRQK
KAQMAAKKKASTGDYKSDSEKGDSEDGEKKDHDKAKDEAPPQHSIEERRAPKKRLGLRKE
PPEAFMASFLAGLEIYQTKMLNYLARNFYNLRFLALFVAFAINFILLFYKVTGDYSEDED
PWNRRGREGEEEDEGALEYFVLQESTGYMAPTLRCLAILHTIISFLCVVGYYYLKKVPLV
VFKREKEIARKLEFAGLYITEQPSDDDIKGQWDRLVINTLSFPNNYWDKFVKRKVIKKYG
DLYGAERIAELLGLDKSALDFNPTEETVAKEASLVSWLSSIDTKYHVWKMGVVFTDNSFL
YLVWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYL
YTVVAFNFFRKFYNKSADDDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYE
LYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDT
TPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRK
QYEDQLG
Download sequence
Identical sequences A0A087Y437
ENSPFOP00000012790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]