SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087Y959 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087Y959
Domain Number 1 Region: 44-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-48
Family Calponin-homology domain, CH-domain 0.000000646
Further Details:      
 
Domain Number 2 Region: 246-306
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 7.59e-18
Family EB1 dimerisation domain-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087Y959
Sequence length 338
Comment (tr|A0A087Y959|A0A087Y959_POEFO) Microtubule-associated protein, RP/EB family, member 2 {ECO:0000313|Ensembl:ENSPFOP00000014562} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MPGPTQALSPNGENNNDIVQDNGTNIIPYRKNTVRGERAYSWGMAVNVYSTSITQETMSR
HDIIAWVNDILCLNYTKVEQLSSGAAYCQFMDLLFPGCISLKKVKFQAKLEHEYIHNFKL
LQASFKRMNVDKIIPVEKLVKGRFQDNLDFIQWFKKFFDANYDGKEYDPVEARQGQDAIP
PPDPGEQIFNLPKKSHHAASSPTAGASRLSSTTPKASTPTSRPSSAKKIPATVSTPVKGE
KELEVQVTHLTEQVNTLKLALEGVEKERDYYFSKLREVEMLCQEQGEENSPFVDRLMEVL
YASDEQDRGDLAEGDGQEADQQAHEATSQDPQEEQDEY
Download sequence
Identical sequences A0A087Y959
XP_007548742.1.10163 XP_014894493.1.100837 ENSPFOP00000014562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]