SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087YMU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087YMU7
Domain Number 1 Region: 220-395
Classification Level Classification E-value
Superfamily MIR domain 6.54e-48
Family MIR domain 0.003
Further Details:      
 
Domain Number 2 Region: 1083-1198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000232
Family SPRY domain 0.052
Further Details:      
 
Domain Number 3 Region: 4034-4112
Classification Level Classification E-value
Superfamily EF-hand 0.000000193
Family Calmodulin-like 0.046
Further Details:      
 
Domain Number 4 Region: 1423-1547
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000411
Family SPRY domain 0.026
Further Details:      
 
Domain Number 5 Region: 424-553
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000000575
Family IP3 receptor type 1 binding core, domain 2 0.014
Further Details:      
 
Domain Number 6 Region: 663-797
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000744
Family SPRY domain 0.085
Further Details:      
 
Domain Number 7 Region: 104-186
Classification Level Classification E-value
Superfamily MIR domain 0.00000419
Family MIR domain 0.023
Further Details:      
 
Domain Number 8 Region: 2173-2243
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000484
Family IP3 receptor type 1 binding core, domain 2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087YMU7
Sequence length 4998
Comment (tr|A0A087YMU7|A0A087YMU7_POEFO) Ryanodine receptor 1a (skeletal) {ECO:0000313|Ensembl:ENSPFOP00000019350} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MAEGADGEEEIQFLRTDDQVVLQCTASILKEQIKLCLSCEGFGNRLCFLETTSNAQQNVP
PDLAICCFILEQSLSVRALQEMLSNSSVDEFLQSSQGGGSRTLLYGHAILLKHTHSNMYL
SCLTTSRSLTDKLAFDVGLQEDATGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSER
YLHLSYASGDLMVDASFMQTLWTMTPVMSGCELAEGFLIGGYVLRLFHGHMDECLAIPCA
DQGDDQRRVAHYEGGAVCSHARSLWRLEPLRIGWSGGHIKWGQSFRVRHITTGRYLFLDE
EKGLLLVDPEKANSKMSAFCFRISKEKIEVAQKRDVEGMGIPEIKYGESMCFVQHVSSGL
WLTYAAVDAKSARLGPLKRKAILHKEGHMDDALTVARSQTEESQAARMIYSTTGLFNQFI
KGLDALSGKNKSANPPSMPMDAVVLSLQDLIFYFRPPEEELEHEDKQFKLRSLKNRQNLF
QEEGMITLVLDCIDRLNVYNTAAHFSEYAGEEAAESWKEIVNLLYELLASLIRGNRANCA
LFCDNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHK
VLDVLCSLCVCNGVAVRSNQNLITENLLPGRDLLLQTDIINYVTSMRPNIFLGTCEGSTQ
YKKWYFEVMVDHVEPFITAQACHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDG
LHLWSGRVPRHVASPSQHILAAEDVVSCCLDLSVPSISFRINGHPVQGMFENFNLDGLFF
PVVSFSAGVKLRFLLGGRHGDFKFLPPPGYAPCYEAVLPRDRLRIEPIKEYKHDFNDVRN
LLGPTQSLSHTAFTPCPVDTIQIVLPPHLERIREKLAENSHELWAVNRIEQGWTFGLFRD
DNKKMHPCLVDFQSLPEPEKNYNLAMSGETLKTLLALGCHVGMGDEKAEENLKRTKLPKT
YMQSNGYKPAPLDLSHVKLTPNQNTLVERLAENGHNVWARDRVRQGWTYSIVQDILNKRN
PRLVPYNLLDEKTKKTNRDTVCAAVRTLIGYGYNIEPPDQESSGHGPGSSRGDKIRVFRA
EKSYAVTQGKWYFEFEAVTVGEMRVGWARPCVRADTELGADELAYVFNGFKAQRWHIGNE
PFGRQWQSGDVVGCMIDLTEMNIMFTLNGEMLISDSGSEMAFKDIEIGEGFIPVCSLGLS
QVGRINLGQNVSSLRYFTICGLQEGFEPFAINMKRDITMWFSKSLPQFITAPTDHPHIEI
SRVDGTVDTPPCLKVTHKTFGSQNANTDLLFFRVSIPIEFHETFKVPAGTTLLTRALTIP
EDQVLEVDPNSDFEILKKSATRKEQEDDKKEPSVPKETLAIKNGENEKDASTEKTKKKGF
LFKAKKAALITPPPVVPTLPRLVEDVVPDDRDDMDIILNTTTYYYSVRIFAGQEPGGVWV
GWVTPDYHQYDLHFDLSKVRNVTVTVGDDRGNIHDSIKRSNCYMVWGGEFGNSQQTRVSQ
EDFVIGCLVDLDTGLMTFTANGKEINTFYQVEPNTKLFPAVFVQPSNQNVIQFELGKLKN
IMPLSAAMFRSERKNPVPQCPPRLDVQMLTPVIWSRMPNNFLAPETGRVSERLGWMVECM
EPLIMMALHIPEESRCIDILELSERMDLLKFHYHTLKLYGSVCALGNNRVAHALCSHVDE
SQLFYAIESTYLPGPMRSGFYDLLISMHLESAKRNRLGTNKEFIVPMTDHTRSITLYTVK
SHALPGVGLTTCLRPKLHFSSVGFVGTDPDIYTLSPTIPLQVLKTKALNMLIEAVQDGSQ
AMRDPVGGSVEFHFVPILKLISTLLIMGVFDDEDVTHILKMIEPTVFHTSKSEEPLEEPS
KANKQEEPSKVAAVKEDEQEVEAEEEEEFEDYGESKEEHLEQGLFQMKLPESVKLQMCTL
LQYFCDCELRHRVEAIAAFSDKFVTQIQSNQRQRYNELMMAFTMSAAETARKTREFRSPP
QEQVNMLMNFKNCPDDEECPVPDEVRESLLVFHNALLTHCGVHIDEAEQEEEVDNSLRGR
LLRLLERVKKFRQKKVEVELEPQEDKKPSTLQELISHTMIHWAQESFIQNPELVRMMFSL
LHRQYDGLGELMRALPKAYTINEVSIQDTMDLLECLGQIRSLLIVQMGPEEERLIIQSIG
NIMSNRVFYQHPNLMRALGMHETVMEVMVNVLGGGDSKEIRFPRVVTNCCRFLCYFCRIS
RQNQRSMFDHLSYLLQNSGIGLGMRGSTPLDVAAASCIDNNEPLVNLPTQGGGKVVKYLA
GCGLQSCPMLLAKGYPDIGWNPCGGEKYLDFLRFAVFVNGESVEENANVVVRLLIRRPEC
FGPALRGEGGNGLLAAVEEAIKISEDPARDGPSIKKDRRFPMFGGEEQQEENRVHLGNAI
MSFYSALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPIEDLVGVISLPVQIPALGKD
NSIIEPKMSASFVPDHKAPMVLFLDRVYGIDNQDFLLHVLEVGFLPDMRAAASLDTAAFS
TTEMALALNRYLCTAVLPLITKCAPLFAGSDHRAIMIDSMLHTIYRLSRGRAFTKAQRDI
IEECLMALCKNLRPAMLQHLLRRLVFDVPILNEYAKRPLKLLTSHYERCWKYYCLPNGWA
NFGVASEEELHLTRKLFWGIFESLAHKKFDAEIFKISMPCLCAIAGAIPPDYVDASYSSK
TEKKASVDAEGNFDPKPVETTNNSTIIPERLDPFINRYAEYTHDKWAFEKIQNNWSYGEV
LDENAKTHPMLRPYKTFSEKDKEIYRWPIKESIKAMLAWEWNIEKAREEEESEKKKAASR
KISQTAQATYDPSHGYSPQPIDVSHMALSRDLQSMAEQLAENYHNTWGRKKKLELQAKGG
GTHPLLVPYDTLTAKEKARDREKAYELLKFLQLNGYAVTRGLKDMESEISSIEKRFAYGF
LQKLLKWMEIAQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILMPLINQYFKNHCLYFLS
TPAKVLGSGGHSSNKEKEMIASIFCKMAALVRHRVSLFGTDASAIVNCLHILARSLDART
VMKSGPEIVKAGLRSFFESAADDVEKMVENLKLGKVSKGNQQVKGVSQNINYTTIALLPV
LTSLFDHVAQHLFGDDVMLDDLQISCYRIMCSIYSVGTVKNPHVERQRPALGECLAHLAA
AMPVAYLEPHLNEFNAFSVYTTKTPRERAILGLPNAVQELCPDIPPLDLLLKEIGDLAES
GARYTEMPHVIEITLPMLCNYLPRWWERGPENFPEMEGQLCTEVTSEHLNQLLGSIMKIV
VNNLGIDEASWMKRLAVFSQPIVSRAKPEMLKSHFIPTMEKLKKRTSKVVAEEDHLRMEG
KSEGDEEDGTIRDEFAVLCRDLYALYPLLIRYVDNNRARWLTCPDPDAEELFRMVGEVFI
FWSKSHNFKREEQNFVVMNEINNMSFLTADSKSKMSKGGDTEGGGSDTERTKKKKRGDRY
SVQTSLIVAALKKMLPIGLNMCSPADQELINLAKIRYSLRDTDEEVREFLQNNLHLQEKV
DNPSMRWQMALYKEMAGKAEDADAPVKVVKRVQEVSAVLYHLEVTEHPFKSKKMVWHKLL
SKQRRRAVVACFRMTPLYNIARHRASNMFLEGYKRNWIQTEGCSFEDRMIDDLSKAMEQE
EAEEEEEKETKPDPLHQLILHFSRTALTEKSKLDTDHLYMAYADIMAKSCHIGEEEEMGE
EMMEQSEDEMSFEEKEMEKQRLLYQQSRLHNRGAAEMVLQMISACKGETGPMVSTTLKLG
ISILNSGNSEVQRKMLEYLKDKKDVGFFLSIQALMQTCCVLDLNAFERQNKAEGLGMVSE
EGTNLNLDRDEKVMADDEFTCDLFRFLQLLCEGHNNDFQNYLRTQTGSTTSINVIICTVD
YLLRLQESISDFYWYYSGKDIIDDPGKKNFSKAMTVAKQIFNSLTEYIQGPCTGNQQSLA
HSRLWDAIVGFLHVFAHMMMKLAQDSSQIALLKELLDLQKDMVVMLLSLLEGRNIVNGTI
ARQMVDMLVESSSNVEMILKFFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFQKAMDSQ
KQYSPSEIQFLLSCSEADENDMINYEEFANRFQEPAKDIGFNIAVLLTNLSEHVPHDSRL
QNFLEQAESVLNYFRPFLGRIEIMGASRKIERIYFEISEVNRRQWEMPQVRESKRQFIFD
VVNEGGESEKMEMFVNFCEDTIFEMNIASQISEQEEEEKGEEDDEGDEGAGQGAAGGAAG
GGGDEDSNGDEERPESTSAFTDFLHSMSSFLSIFTFRNLRRQYRRIRKMTFKEIVVALSK
FFWAILMSILTFIYNVCKGFFVIIWQALFGGGLVEGAKNITVTEILASMPDPTQDDVHGD
GPGELGTGEEQETGGITDTGESGSGEEEEEDTQENEGGRIPGMDAPGGLGDMGVEEPVEP
PTPEGSPITKRKMPEESDASQKPPEPAPVEETPPEPEKSDVETGEKQGGFQIWTELETQR
NKFMNYLSRNFYNLRFLALFLAFALNFILLFYRVSDTPPEGDEMEGSGLSEGSGLFEGSG
LFEGCGDEAEGSGADGGGEDEEEDVLLYYYLEESTGYMQPTLSFLAILHTVISFICIIGY
NCLKIPLVIFKREKELARKLEFDGLYITEQPEDDDIKGQWDRLVLNTPYSFPHNYWDKFV
KRKVLDKYGDIYGRERIAELLGVDLASLDVSQQHEKKQEEPDNSVFAWVTSIDIKYQIWK
FGVVFTDGTFLYLCWYLVMSLLGHYNNFFFACHLLDIAMGVKTLRTILSSVTHNGKQLMM
TVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGD
EIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCF
ICGIGSDYFDTTPHGFETHTFDEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCW
DFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences A0A087YMU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]