SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087YSP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087YSP1
Domain Number 1 Region: 63-159
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-23
Family SH2 domain 0.0000148
Further Details:      
 
Domain Number 2 Region: 179-226
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000602
Family SOCS box-like 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087YSP1
Sequence length 227
Comment (tr|A0A087YSP1|A0A087YSP1_POEFO) Suppressor of cytokine signaling 2 {ECO:0000313|Ensembl:ENSPFOP00000021044} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MAPKPPVSVFFCSRSLPTNLSRFFGGFLICPMTCQSSESQEAIEDARGADDGARTEESDE
SRVASAMKELRKTGWYWGGLTANEAKEILQNSSEGSFLLRDSSQRDFLFTISAMTSAGPT
NLRIEFRHGKFKLDSVVLVKPKLKQFDSVVHLVEHYVQLSRSGGRAAPAPPGPNGTIQLL
LTRPVYAAVPSLQHLCRISINRSARQVQDLPIPNRLKDYLTDYAYNV
Download sequence
Identical sequences A0A087YSP1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]