SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087ZQ48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087ZQ48
Domain Number 1 Region: 89-217
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 5.23e-28
Family V-type ATPase subunit E 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087ZQ48
Sequence length 226
Comment (tr|A0A087ZQ48|A0A087ZQ48_APIME) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:GB40887-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN=Vha26 OC=Apoidea; Apidae; Apis.
Sequence
MALSDADVQKQINHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKK
EKQVELQKKIQSSNMLNQARLKVLKVREDHVRNVLDEARKRLGEVTRDISRYREILKLLI
VQGLCQLTENHVTIRVRQVDLPLVESLLDSVQNAYKQITKKDVTIKVDQDNFLPSDSCGG
VDLFAAKGRIKVSNTLETRLELIAQQLIPDIRSALFGCNPNRKFID
Download sequence
Identical sequences A0A087ZQ48
XP_625098.1.77095 7460.XP_625098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]