SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A088A5K3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088A5K3
Domain Number 1 Region: 239-423
Classification Level Classification E-value
Superfamily MIR domain 8.72e-60
Family MIR domain 0.000000109
Further Details:      
 
Domain Number 2 Region: 424-594
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.09e-51
Family IP3 receptor type 1 binding core, domain 2 0.000000423
Further Details:      
 
Domain Number 3 Region: 1116-1144,1179-1290
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.57e-38
Family IP3 receptor type 1 binding core, domain 2 0.0054
Further Details:      
 
Domain Number 4 Region: 108-220
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000000981
Family MIR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A088A5K3
Sequence length 2812
Comment (tr|A0A088A5K3|A0A088A5K3_APIME) 1,4,5-trisphosphate receptor {ECO:0000313|EnsemblMetazoa:GB46583-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN= OC=Apoidea; Apidae; Apis.
Sequence
MGEILGSASFLHLGDIVSLYAEGSVSGFLSTLGLVDDRCVVCPEAGDLSNPPKKFRDCLF
KICPMNRYSAQKQFWKAAKQSAGGTDAVLLKRLHHAAEIEKKQNETENKKLLGSVVSYGN
VVQLLHLKSNKFLTVNKRLPALLEKNAMRVYLDANGNEGSWLYIMPFYKLRSDGDSVVVG
DKVILEPVNAGRQGLHVAANYELSDNPGCKEVNVVNSATSWKVTLFMEHRENQEEILKGG
DVVRLFHAEQEKFLTMDEYKKKQHVFLRTTGRTSATAATSSKALWEVEVVQHDPCRGGAG
HWNSLFRFKHLATGQYLAAEIDTDEPRETTKGKRDPPGPVYRLVSVPHSNEISSLFELDP
TTLTRGDSLVPQSSFVRLHHICTNTWVHSTSVPIDKDDEKPVMSKVGCAINKEDKEAFAL
RSVSPVEVRDLDFANDACKVLASISSKLEKGTISHNERRAVTSLLQDIVYFIAGLENEQN
KSEALDLIVTNAVRDRQKLLREQYILGQLFKILQAPFLESAEGEGPFLRIEELNDPRHAP
YKYMFRLCYRILRLSQQDYRKNQEYIAKHFAFMQKQIGYDILAEDTITALLHNNRKLLEK
HITAAEIETFVGLVRKNMHNWESRFLDYLSDLCISNRKAIAVTQELICKSVLSEKNKDIL
IETKMTKTQVEVEELDEKQENDEPRITVMEEYEIFLIWNNGTKSMSLNELSRGAKIGNIQ
DAAILDYYRHQLNLFSNMCLNRQYLALNNLSPHLDIGLILKCMEDETVPYELRASFCRLM
LHLHVDRDPQEQVTPVKYARLWSEIPSKMSINDYDANRMRDQNKEAVRAKFSATIMFVED
YLCNVVAKMWSFADQEQNKLTFEVVKLARDLIYFGFYSFSDLLRLTKTLLSILDCISEND
VADGKIPTGEIDSDSVDSQDIAEGGVLRCIGDMGAVMTSLTLGPAGQVLAGSSSPRPKPL
LKKEYPLVMDTKLKIIEILQFILDVRLDYRISCLLSIFKQEFDETERASGDLSLGQKTID
LELIGTQAEGIFGSSEECVALDLDGQGGRTFLRVLLHLAMHDYPPLVSGALHLLFRHFSQ
RQEVLQAFKQVQLLVSDSDVESYKQIKSDLDVLRQSVEKSELWVYKSKASEEHGNKKKKN
KEDEDDGATPRKAPPQLSTTDKKGSAIDLDIGPPLHADQAEEYKKIQQILIRMNKLCIQT
IGGQIKPRKHEQRLLRNVGVHTVVLDLLQVPFDAKEDVRMNELMRLAHDFLQNFCLGNQQ
NQVLLHKQLDLFLNPGIREAQTICSIFQDNSTLCNEVSAKVIQHFVHCIETHGKHVQYLK
FLQTIVKAENQFIRKCQEMVMQELVQAGEDVLVFYNDRASFNHFVEMMRSERHRMDESSP
LKYHVELVKLLACCTMGKNVNTEIKCHSLLPLDDIVAMVSHPDCIPEVKEAYINFLNHCY
IDTEVEMKEIYTSNHMWSLFEKSFIVDMGIIATATHDREHADISLENYVTGCLMNIITTF
FSSPFSDQSTTVQKHLHEARLYWNIKESDRITDTNLAGCTRQPIFVQLLHAAFKVSQCSW
LNAGQRFNVENCIRTLSDVAKGRGIAIPTDLESQVASMFNKAAMLSRQTSKWLQAAKQPK
IERTQSQSDLICEEDREEKDQLMRLDRSIIEGLQDIVSLLEEQLKPLVQSELSLLVDILY
RPELLFPAATDARKRCENGGFIKRLIKHTEKLLEEKEEKLCVKVLRTLREMMAIDPEYGE
KSEDVLEKEETEQKAESQVGTDSVDESETRPMTQQERGDALRNNLLARYFGKSFIQKPET
VEIGVSHSAPVTHGPGAKLLSRAGRTLHEIQSHLDREGASDLVVELVIKSVHSPSIFVEA
IELGIALLEGGNPIIQKSVYNKLMGGDLSQSFFKVFYDKMKDAQQEIKSTVTVNTSDIAA
KAHEDKEQNKEIEKISRKRTSGKPNGIVITDELREELNQAASSTVQAYANVRNLASGDDA
SNNAALGSALEDMIAEKLERHRTGTSGTERDEGQLSAKVLVMQPILRFLQLLCENHNRDL
QNFLRNQNNKTNFNLVSETLMFLDCICGSTTGGLGLLGLYINEHNVALINQTLETLTEYC
QGPCHDNQNCIATHESNGLDIITALILNDINPLGKTRMDLVLELKNNASKLLLAIMESRG
DSENAERIMYNMNPKQLVDVACRAFHQESLDDDGDTDDSSTDGEEGVSPKEVGHNIYILC
HQLAQHNKELASMLKPSEQNNADPKINKALQYYATHTAQIEIVRHDRTLEQIVFPIPEIC
ELITLDTKIKVLHTTERDDQGSKVSDFFERTEDMFNEMKWQKKLRGQPVLFWMSSYMSLW
SNILFNCAVLINLIVAFFYPFVDSVPKLSSHLSALIWTVMLSSAVIVITLPRESGIRTLV
ASTILRLIFSIGPKPTLWLLGFLTVVLKVVHLISIIGNQGTLTKSLEQIVTNVELLYHIS
YLIFCVLGICMHPFFYSVLLFDVVYREETLLNVIRSVTRNGRSIILTAVLALILVYMFSI
IGFMFFKDDFLVTVDENLASSYVTENVDTCNAVDNEKCEATETVSRYIREAHEKDSLAEV
INVGGELKERACDSLVMCIVTTLNQGLRNGGGIGDILRAPSSTEPLFVARVVYDLLFFFI
VIIIVLNLIFGVIIDTFADLRSEKQQKELILKNTCFICGLNRSSFDNKTVSFEEHVKHEH
NMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKDRNLDWFPRLRAKSLAADEGEGEQVELR
SLQSQLESTQQLVKCLSQQLTELRDQMTEQRKQKQRLGLLNSASAFLHNVPA
Download sequence
Identical sequences A0A088A5K3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]