SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A088ATG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088ATG7
Domain Number 1 Region: 349-540
Classification Level Classification E-value
Superfamily MIR domain 1.83e-56
Family MIR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088ATG7
Sequence length 781
Comment (tr|A0A088ATG7|A0A088ATG7_APIME) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:GB54994-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN=LOC551420 OC=Apoidea; Apidae; Apis.
Sequence
MIVRRRRRILDNKQSQVQSAKFEYEHISTNCNENVQRDEKDEIVSNTIEKFKIVEIPVNT
ALKTRIKISLEIDLISVILLVTGIVTRFYRLEEPRSIVFDELHYGKYVGLYMKKTFFFDS
HPPLGKQLISAAAYVAGFDGQFKFDRIGSPYSDIVPLFALRLVPALCGSLLIPTAYHLIL
ELGLKQWTATLAGILLLFDNALLTQSRFILMESILMQFSLFGLICIMKFRKVMDQPTNLS
WWIWLILGIANLTCALCVKYVGLYSLILSLFLIAYDYWNLIPRKTLSSTVLCIHLIIRIF
VILSIICIIYLTVFYIHLTTLSKAGPHDSVMTSAFQASLDGGLASITKGQPLEVTHGSQI
TLRHTYGRACWLHSHNHMYPLRYPDGRGSSHQQQVTCYSFKDVNNWWIVKKPERNDLVVT
KPSEPIKHGDIIQLVHGITSRALNSHDVAAPMTPQSQEVSCYIDYNVSMPAQNFWKVEIS
NKDSTGDVWHAIQSQVRLIHVNTDYALKFSGRQLPDWGFNQHEIVADRLIDQTDSIWNVE
EHRYTKSEDQKQRERELINAEMIPLQATTLNFWEKFVELQIKMLFSGQEGQNSHMYSSDP
LDWPLMSRGIAYWVSNDSNAQVHLLGNIAIWYSGTICIIIYSFLLIFYILRRRRMCFDIT
HEEWNKFSNIGSILLTGYLLHFLPFIFVEKTLFLHHYLPAFIFKLLLTAATIEHLYYFIR
IRYRHNFLMYILKFGIITWLIFVIYIFKKFSVLSYGTTNLSAKEVLKLRWKDTWDFIIHK
T
Download sequence
Identical sequences A0A088ATG7
NP_001265265.1.77095 XP_016767733.1.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]