SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A088C8V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088C8V6
Domain Number 1 Region: 6-114
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-31
Family Capz alpha-1 subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A088C8V6
Sequence length 116
Comment (tr|A0A088C8V6|A0A088C8V6_9POAL) F-actin capping protein alpha subunit {ECO:0000313|EMBL:AHN93199.1} OX=886359 OS=Phyllostachys nigra var. henonis. GN= OC=Phyllostachys.
Sequence
LPSAYIEEFRSSLDVELSKYVGKAYPKGVCAVYCTSGKDVEGPGADFGLAVVISCARRSP
QNFCNGSWRSIWTLEFSDELQFVEIKGKIQVGAHYFEEGNVQLDANIDCKDSTILQ
Download sequence
Identical sequences A0A088C8V6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]