SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088C9E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088C9E8
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-53
Family Capz alpha-1 subunit 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A088C9E8
Sequence length 174
Comment (tr|A0A088C9E8|A0A088C9E8_9POAL) F-actin capping protein alpha subunit {ECO:0000313|EMBL:AHN93195.1} OX=146655 OS=Fargesia spathacea. GN= OC=Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Fargesia.
Sequence
SALDVELSKYVGEAYPKGLCAVYCTSGKDVEGPGADFCLAVVISAVRRSPQNFCNGSWRS
IWTLEFSDELQFVEIKGKIQVGAHYFEEGNVQLDASIDCKDSTILQSPEDCALSITNIIR
HHESEYLSSLEETYLNLSDATFKDLRRKLPVTRTLFPWHNTLALSLTRDLAKEL
Download sequence
Identical sequences A0A088C9E8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]