SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A088E8U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088E8U1
Domain Number 1 Region: 4-165
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.27e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A088E8U1
Sequence length 191
Comment (tr|A0A088E8U1|A0A088E8U1_9CREN) Pyruvate ferredoxin/flavodoxin oxidoreductase {ECO:0000313|EMBL:AIM27735.1} KW=Complete proteome OX=43687 OS=Metallosphaera sedula. GN=HA72_1596 OC=Metallosphaera.
Sequence
MDKLSVLIAGIGGQGVVTLGKIIAEAFASKGYRVFEAETHGLSQRGGAVNVHVRIGNVEA
PLIPRGGADIMIALEATEALRNVEYLSREGEIFLNASVKPPSLPKVQEYDVRMIIERLRD
WKVHVLDCNELVGKAGKCNTALLGVVYQARFSQYLERDDFLSVLRDENNRNSFLAGVRFW
ERSKEKALMTQ
Download sequence
Identical sequences A0A088E8U1 A4YH49
WP_012021538.1.15515 WP_012021538.1.27320 WP_012021538.1.28583 WP_012021538.1.31166 WP_012021538.1.34633 WP_012021538.1.8883 WP_012021538.1.99084 399549.Msed_1596 gi|146304359|ref|YP_001191675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]