SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088NUH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088NUH0
Domain Number 1 Region: 187-232
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000194
Family Ovomucoid domain III-like 0.0066
Further Details:      
 
Domain Number 2 Region: 91-156
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000177
Family Ovomucoid domain III-like 0.0013
Further Details:      
 
Domain Number 3 Region: 24-66
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000144
Family TB module/8-cys domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A088NUH0
Sequence length 250
Comment (tr|A0A088NUH0|A0A088NUH0_SINCH) Follistatin-related protein 3 {ECO:0000313|EMBL:AIN56734.1} OX=119488 OS=Siniperca chuatsi (Mandarin fish). GN=FSRP-3 OC=Eupercaria; Centrarchiformes; Centrarchoidei; Sinipercidae; Siniperca.
Sequence
MSFFISVFAVILTLHQIGRNPASAGMCWLQQSQDQRCDMVLMRGVTREECCAGDRLDTAW
SNTSLPMNEVSLLGFLGIVSCKPCKETCEGVKCSPGKVCKMKTGRPQCVCSPDCTNISRK
HAVCGSDGKSYNDECTLLMARCMGHPDLEVMYQGDCKKSCSNVVCPGTHTCVTDQTNSAH
CVMCRATPCPIPTPSEQPICGNDNITYPSACHLRRATCFLGRSIGVRHYGNCSNPPRKPQ
DFEGSEENAV
Download sequence
Identical sequences A0A088NUH0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]