SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088S0G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088S0G7
Domain Number 1 Region: 23-64
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000842
Family SAP domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A088S0G7
Sequence length 219
Comment (tr|A0A088S0G7|A0A088S0G7_9TRYP) Uncharacterized protein {ECO:0000313|EMBL:AIO01734.1} KW=Complete proteome OX=5679 OS=Leishmania panamensis. GN=LPMP_341080 OC=Leishmaniinae; Leishmania; Leishmania guyanensis species complex.
Sequence
MKAFFITVLVAILAATLVSAGMTESDFKKMKVKDLRGFLMDRGLECIGCQEKSDFVRMAY
QHRDKSPIGSAKKREIPSKKFWEAWSDIAKQECQNAVKRRGNDADAEPFSIICDTIHSAA
DSYLMQHGRRVANQLKKTPLHLLETSFKDVYYEAGLHLFQTLADYCLASPSSQTACQSLG
SVLSTMDGSSGANFKVWTTNVGIENTNPMYDIIGEHADL
Download sequence
Identical sequences A0A088S0G7
XP_010702534.1.42505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]