SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A088U4J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088U4J4
Domain Number 1 Region: 731-973
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.1e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.02
Further Details:      
 
Domain Number 2 Region: 27-225
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.14e-16
Family Pyruvate oxidase and decarboxylase PP module 0.058
Further Details:      
 
Domain Number 3 Region: 441-628
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000656
Family Pyruvate oxidase and decarboxylase PP module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088U4J4
Sequence length 1190
Comment (tr|A0A088U4J4|A0A088U4J4_9BURK) Uncharacterized protein {ECO:0000313|EMBL:AIO32193.1} KW=Complete proteome OX=95486 OS=Burkholderia cenocepacia. GN=DM39_3033 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MTARLPIDGTPALSDYRLTDNLSATRGRIFLTGTQALVRLLLMQRAADTAQGLNTAGFVS
GYRGSPLGMVDQQLWKAKKLLDASGVRFLPAINEELGGTAVLGTQRVEADPERTVDGVYA
MWYGKGPGVDRAGDALKHGNAYGSSPHGGVLVVAGDDHGCVSSSMPHQSDFAMMAWHMPV
VNPSNIADMLEFGLYGWALSRYSGAWVGFKAISETVESGSTVDLDALQTHWPAPQGFTAP
AGGLHNRWPDLPSLTIEARLAAKLDAVRHFARTNSIDKWIAPSAQANVGIVTCGKAHLDL
MEALRRLDLTVADLDAAGVRIYKVGLSYPLEMTRIETFVDGLAEVLVIEEKGPVIEQQIK
DYLYNRPDAARPRVLGKHDAAGACLLSELGELRPSRILPVFAEWLARHKPALDRRERVVD
LVAPQILSNEADAVKRTPYFCSGCPHNTSTKVPEGSIAQAGIGCHFMASWMERDTTGLIQ
MGGEGVDWAAHAMFTNTKHVFQNLGDGTYFHSGILAIRQAVAAKANITYKILYNDAVAMT
GGQPVDGSISVPQIARQVEAEGVSRFVVVSDEPQKYDGHHGLFPAGTTFHHRSELDAVQR
ELRETPGVTVLIYDQTCAAEKRRRRKKGEFPDPDKRLFINDAVCEGCGDCGVQSNCLSVE
PLETPLGRKRRIDQSSCNKDYSCVNGFCPSFVTVEGAALKKAAGAAFDEAALAARVDALP
VPATHLDAAPYDMLVTGVGGTGVVTVGALISMAAHLEGKSASVLDFMGFAQKGGSVLSFV
RIASSDRWLNQVRIDTQQADVLLACDMVVGASAEALQTVRHERSRIVVNTHRIPNASFVQ
NPDANLHADALLEKMRHAAGDGFLSSCDAQALAAKFLGDTIGANILMLGYAWQLGLVPVS
LAAMMRAIELNNVAVPMNKLAFSVGRMAAGDAAGLDALWNARHAVAVPAAPQTLDELIAD
REARLLAYGGARYVERYRALVSAARAKGDDALTRAVATTFYRLLAVKDEYEVARLYADGA
FRTALEAQFEGVPGQDYRVKFNLAPPTVAKAGRDGSAPRKRVFGQWMWPVFGAMARVRGL
RGTWLDPFGRTVERRMERALADDYETTLTRAFAVTTAGNAARVAQLAELHARVRGFGHVK
LRNLAGVKRAERELALQLGIDAATSAAVQHALDEMKGAGMLKGIPVVVAK
Download sequence
Identical sequences A0A088U4J4
WP_040128360.1.65410 WP_040128360.1.82257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]