SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A089FYX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089FYX0
Domain Number 1 Region: 221-398
Classification Level Classification E-value
Superfamily MIR domain 1.31e-37
Family MIR domain 0.0032
Further Details:      
 
Domain Number 2 Region: 1092-1219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-21
Family SPRY domain 0.032
Further Details:      
 
Domain Number 3 Region: 671-806
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000091
Family SPRY domain 0.067
Further Details:      
 
Domain Number 4 Region: 104-188
Classification Level Classification E-value
Superfamily MIR domain 0.0000000392
Family MIR domain 0.019
Further Details:      
 
Domain Number 5 Region: 4215-4273
Classification Level Classification E-value
Superfamily EF-hand 0.00000055
Family Polcalcin 0.044
Further Details:      
 
Domain Number 6 Region: 2274-2356
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000209
Family IP3 receptor type 1 binding core, domain 2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A089FYX0
Sequence length 5133
Comment (tr|A0A089FYX0|A0A089FYX0_9NEOP) Ryanodine receptor {ECO:0000313|EMBL:AIP90097.1} OX=499550 OS=Grapholitha molesta. GN= OC=Tortricoidea; Tortricidae; Olethreutinae; Grapholitini; Grapholitha.
Sequence
MAEAEGGASEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIAGKNIPPDL
SQCVFVIEQALSVRALQELVTAAGSETGKENLGKGTGSGHRTLLYGNAILLRHLNSDMYL
ACLSTSSSQDKLAFDVGLQEHSQGEACWWTLHPASKQRSEGEKVRVGDDLILVSVATERY
LHTTKENEVSIVNASFHVTHWSVQLYGTGISRMKYVGYVFGGDVLRFFHGGDECLTIPST
WSTEGGQNIVVYEGGSVMSQARSLWRLELARTKWAGGFINWLHPMRIRHITTGRYLGVND
QNELYLIQRDEATTASCAFYLRQEKDDQKVVLEDKDLEVIGSPIIKYGDSTVIVQHSETG
LWLSYKSYETKRKGVGKVEEKQAILHEEGKMDDGLDFSRSQEEESRTARVIRKCSSLFTK
FITGLETLQENRRHSMFFASVNLGEMVMCLEDLINYFAQPDEEMEHEEKQNKFRALRNRQ
DLFQEEGILNLILEAIDKINVITSQGFLAGFLAGDESGQSWEMISGYLYQLLAAIIKGNH
TNCAQFANSNRLNWLFSRLGSQASGEGTGMLDVLHCVLIDSPEALNMMRDEHIKVIISLL
EKHGRDPKVLDVLCSLCVGNGVAVRSSQNNICDYLLPGKNLLLQTALVDHVSSVRPNIFV
GRVEGSAVYQKWYFEVTMDHIEKTTHMMPHLRIGWANTSGYVPYPGGGEKWGGNGVGDDL
YSFGFDGANLWSGGRKTPVNRNYADEPFIRKGDVIGCALDLTVPIISFMFNGVRVTGSFT
NFNLEGMFFPVISCSSKLSCRFLLGGEHGRLRYAAPEGYSPLVESLNPQQVLSLEPCFYF
GNLAKRALAGPPLLQDDTAFVPTPVDTTLITLPSYVEQIRDKLAENIHEMWAMNKIEAGW
MYGDQREDLHKIHPCLVPFERLPAAEKRYDIQPAVQTLKTILALGYYISLDKPPARIRNV
RLPNEPFMQSNGYKPAPLDLSAVTLTPKMDELVDQLAENTHNLWARERIQQGWTYGLNED
PDMHRSPHLVPYPKVDDAIKKANRDTASETVRTLLVYGYMLDPPTGEQHEALLLEASKQK
QADFRTYRAEKNYAVGSGKWYFEFEILTAGPMRVGWAHADMAPGMMLGQDENSWAFDGYN
EEKVYSGSTESFGKQWAVGDVVGVFLDLIDKTISFSLNGELLMDALGGETTFADVQGDNF
VPACTLGVGQKARLTYGQDVNSLKFFTMCGLQEGYEPFCVNMKRDVTHWYTKDQPIFENT
DEMIDTRIDVTRIPAGSDTPPCLKISHNTFETMEKANWEFLRMSLPVICHAQFIDEQEKA
RRWVEIKERQQMLMKEAADAQMPAHIDQITRSGFTMNDIKGLHYDEAEEPKLNLKRQPSR
PPRKGSVGRNVTIQNYNLQPGQVNGMHRTTSEAEMSKYELGVQSAADDKKDKRGRSPFKF
FKSKRGESGDRSKSRKSKTPDPFSDGELSPERSGMRRPNPQIRVSQANTRYDAQYSRSSK
PYLFDQNTNLNNLQVPTPQQGRKEMTTSTLAAAQTETVGNEIFDAECLKLINEYFYGVRV
YPGQDPTHLYVGWVTTQYHLHSRDFNQSKVMKSSVIITDDYDRVIESVERQSCYMVRADE
LYNEVMAEAAGAKGASQGMFIGCSVDTSTGIVSWTCEGKDTSFKYKMEPEIKLFPAIFVE
ATSKEILQIELGRSSTSLPLSAAVLPTSDKHVIPQFPPRLKIQCLKPHQWARVPNLSLQV
HALKLSDIRGWSMLCEDAISMLALHIPEEDRCIDILELIEMDKLLSFHSHTLTLYAALCY
QSNYRAAHALCQHVDQKQLLYAIQSQYMSGPLRQGFYDLLIALHLESHATTMETCKNEFV
IPLGPELKALYDEPDMQHSLRSLQCESVRPQMKMTDIAENISDISNLYSPNFPLEVVREF
VMQALAEAVETNQVHNRDPVGGSNENLFLPLIKLVDRLLLVGMMRDEDVEKLLIMINPET
WDPTFDKEGKDEHRKGLLHMKMAEGAKLQMCYLLQHLNDLQLRHRVEAIIAFAHDFVGDL
QTDQLRRYIEIKQSDLPSAVAAKKTREFRCPPREQMNAILSFKHMDLEEEAEKDNIPCGE
ELIARMSEFHEGLMSHVSLSALQEPEVPESTEPEVKPGTIGKIYNIINTVKELEEEPKAI
EEPPRKTPEEKFRKVLIQTIVSWAEEAQIETPKLVREMFSLLVRQYDSVGELIRALEKTY
VINAKTKLGVAEMGVGLSQIRALLPVQMSQEEEELMRKRLWKLVNNHTFFQHPDLIRVLR
VHENVMAVMMNTLGRRAQAQSDAAPANPPAAEDKEKDTSHETVVACCRFLCYFCRTGRQN
QKAMFDHFDLLLENSNILLSRPSLRGSTPLDVAYSSLMENTELALALREHYLEKIAIYLS
RCGLQSNSELVEKGYPDLGWDPVEGERYLDFLRFCVWVNGESVEENANLVIRLLIRRPEC
LGPALRGEGEGLLKAIVDANKMSERIADRRKLREMEQEGDTTFSHPLPESDEDEDYIDTG
AAILNFYCTLVDLLGRCAPDAGVIALGKNESLRARAILRSLVPLEDLQGVLSLRFTLHNP
AAGEERPKSDMPSGLIPGHKQSVVLFLERVYGIETQELFYRLLEEAFLPDLRAATMLDRN
DGCESDMALSMNRYIGNSILPLLIKHANFYNEAENYASLLDATLHTVYRLSKNRMLTKGQ
REAVSDFLVALTSAMQPSMLLKLLRKLTVDVSRLSEYTTVALRLLTLHYERCAKYYGSSG
SGGSSDEEKRLTMMLFSNIFDSLSKMDYDPELFGKALPCLIAIGCALPPDYSLVKNYDDE
FYGKEQQSTGGPDNPQYDPQPINTSSVALNNDLNTIVQKFSEHYHDAWASRKIENGWVYG
ESWSDSQKSHPRLKPYNMLNDCEKERYKEPVRESLKALLALGWSVEHSEVDLPSTNRSSM
RRQSKSGGRPADVVTDSATPFNYNPHPVDMTNLTLSREMQNMAERLADNAHDIWAKKKKE
ELTTNGGGIHPQLVPYDLLTDKEKKKDRERSQEFLKYLQYQGYKLHRPSKASQSDTEQTT
TGVAIELRFAYSLLEKLIQYIDRATINMKLLKPSTTFSRRTSFKTSTRDIKFFSKVVLPL
MEKYFSTHRNYFIAVATATNNVGAASLKEKEMVAALFCKLASLLRSRLAAFGPDVRITVR
CLQVLVKGIDAKSLVKNCPEFIRTSMLTFFNNVADDLGHTILNLQDGKYAHLRGTHLKTS
TSLGYINGVILPVLTAMFDHLANCEYGADLLLDEIQVASYKILGSLYTLGTDASLTHDRK
YLKTEIERHKPALGSCLGAFSSTFPVAFLEPHLNKHNQFSLLNRIADHSLEAQDIMAKME
QSMPTLETILGEVDQFVESDKTYVEAPHIIDVVLPLLCSYLPFWWAQGPDNVTPTQGNHV
TMVTAEHMNQLLKNVLKLIKKNIGNENAPWMTRIATYTQQIIINSSEELLRDVFLPLAER
VRKRTDTMFHKEESLRGFIKSSTDDTSQVESQIQEDWQLLVRDIYSFYPLLIKYVDLQRN
HWLRNNVNEAEELYNHVAEIFNIWSKSQYFLKEEQNFISANEIDNMVLIMPTATRRVTTV
VDGAPQGGGKKKKKHRDKKRDKDKEVQASLMVACLKRLLPVGLNLFAGREQELVQHCKDR
FLKKMSEQDVAEFAKIQLTLPDKIDPADEMSWQHYLYSKLGSKSKAAVADNTAEAKAKII
DDTVERIVAMSKVLFGLHMIDHPQQMSKNVYRSVVSIQRKRAVIACFRCLSLHSLTRHRA
CNIFARTYYELWLEEENIGQEVMIEDLTQSFEDAELKKSDVVEEEGKPDPLTQLVTTFCR
GAMTERSGALQEDPLYMSYAHIIAKSCGEEEEEGGGEEEEGGGEEAAAGEEESKASIHEQ
EMEKQKLLFHQSRLADRGVAEMVLLHISASKGIPSDMVMKTLQLGISILRGGNIDIQMGM
LNHLKDKKDVGFFTSIAGLMNSCSVLDLDAFERNTKAEGLGVGLEGAAGEKNMHDAEFTC
ALFRFIQLTCEGHNLEWQNYLRTQAGNTTTVNVVICTVDYLLRLQESIMDFYWHYSSKEL
IDPAGKANFFKAIGVASQVFNTLTEVIQGPCTQNQQALAHSRLWDAVGGFLFLFSHMQDK
LSKHSSQVDLLKELLNLQKDMITMMLSMLEGNVVNGTIGKQMVDTLVESAGNVELILKYF
DMFLKLKDLTTSASFMEIDANSDGWVLPKDFKEKMEQQKSYTPEEIEFLLACCETNHDGK
MDYIGFCDRFHEPAKEIGFNLAILLTNLSEHMPNEPRLARFLETAGSVLNYFEPFLGRIE
IMGGSKRIERVYFEIKEENIEQWEKPQIKESKRAFFYSIVTEGGDKEKLEAFVNFCEDAI
FEMTHASGLMAASEEQGGGSKSREAAYMYLGDDDDETKGKDPFRRGLQSIKDGFATAFSS
LSPANIKSKIADMQQMPPAELAVGFFKMFFYLFYYMGYAVLVVVRYIFGVLLGLMRGPQT
EEVPPEPTEEEKIGQLRHRLLAQSQSPSRLLPALPAADDTGQMQVSAFGLDISKEDNGQI
QVKPHESPTTSTPSSGEEAEASPDEAVEHSEEQQPPSLIDLLGGEQAKKQAQERLEAQAA
QQAAMSAIEAESKKAVQAPTPSAVSQVDISQYTKRAVSFLARNFYNLKYCALILVFCINF
VLLFYKVSTLDGDDEGSGLGDIVSGSGSGAGSGSGDGSGESGEDEDPLEIVHIDEDFFYM
EHVIKAAAVLHSIVSLAILIGYYHLKVPLAIFKREKEIARRLEFDGLYIAEQPEDDDIKS
HWDKLVISAKSFPVNYWDKFVKKKVRTKYSETYDFDSISNMLGMEKTSFAAHEETGNKGF
FQCILNVDWRYQLWKAGVTFTDNSFLYSLWYFCFSVMGNFNNFFFAAHLLDVAVGFKTLR
TILQSVTHNGKQLVLTVILLTIIVYIYTVIAFNFFRKFYVQEEDDEVNRNCHDMLSCFVF
NIYKGVRAGGGIGDELEPPDGDDSEVWRIIFDVSFFFFIIIILLAIIQGLIIDAFGELRD
QLESVKEDMESNCFICGMGKDYLDLVPHGFDTHVQREHNLANYMFFLMHLINKPDTEYTG
QETYVWNMYTQRCWDFFPVGDCFRKQNETEMTE
Download sequence
Identical sequences A0A089FYX0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]