SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A089IQB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089IQB5
Domain Number 1 Region: 252-442
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.71e-60
Family Methylesterase CheB, C-terminal domain 0.0000096
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 7.54e-32
Family CheY-related 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A089IQB5
Sequence length 443
Comment (tr|A0A089IQB5|A0A089IQB5_9BACL) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=1536775 OS=Paenibacillus sp. FSL H7-0737. GN=H70737_18720 OC=Paenibacillus.
Sequence
MKPYKVLVVDDSAFMRKIISDLIENDADFQVTATATNGREAIEKINKLRPDLVTMDVEMP
EMNGLEALKIIMASDPLPVIMLSGINEEGMKETILALEWGAFDFIRKPSISNSQDITGVG
ESLREQMKEAMLAREQREARASAFRMPEITPLEPLLPTAPRLLPDKSKAALKSSLKDEEM
RKPRGKQPVDSTIPKKATKPIISAKTPLIEKSKPKTKVENKPFPPKPVIESLVEVSTESP
GLTPDRMVGSENLHKLVAVGCSTGGPRALKVLLEKIPADFPAPIVIVQHMPPNFTKSLAQ
RLNTFSPLEVLEAEQGMILRKGAAYIAPGGYHLQVTPTSKGQYAVVLTKEEARNGHRPSV
DVLFESLLPLTSLDRHVLLMTGMGSDGARMMKSLYDSGVTSTFAESEETCVVYGMPRSAV
ELQCVKYVLPLQEIAPRLVQAVK
Download sequence
Identical sequences A0A089IQB5
WP_042189435.1.21252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]