SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089NS20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089NS20
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 6.67e-18
Family F1F0 ATP synthase subunit C 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A089NS20
Sequence length 75
Comment (tr|A0A089NS20|A0A089NS20_9RHIZ) Lipid-binding protein {ECO:0000256|HAMAP-Rule:MF_01396} KW=Complete proteome OX=693986 OS=Methylobacterium oryzae CBMB20. GN=MOC_0893 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MDPVAAKYIGAGLACLGMAGAGIGLGNLFGQFLAGALRNPSAADGQRATLLLGFALTEAL
GIFSLLIALLLLFAV
Download sequence
Identical sequences A0A089NS20 A0A0E9K9K4 A0A0L6JCI0 A0A0M8ZFY8 A0A0N0B4A6 A0A0V7YZ19 A0A154NWI7 A0A1G5TH64 A0A1G9T2Y2 A0A1H5YDZ3 A0A1I3K581 A0A1I4T092 A0A1I6PZ48 A0A1I7G700 A0A2E7YNX5 A0A2E9S698 B1LWM2 I9WQM9 M7Y254
WP_007566773.1.100277 WP_007566773.1.11150 WP_007566773.1.17008 WP_007566773.1.25698 WP_007566773.1.28011 WP_007566773.1.3059 WP_007566773.1.30774 WP_007566773.1.31760 WP_007566773.1.35747 WP_007566773.1.3669 WP_007566773.1.41920 WP_007566773.1.45562 WP_007566773.1.47287 WP_007566773.1.47484 WP_007566773.1.47682 WP_007566773.1.49077 WP_007566773.1.49457 WP_007566773.1.5195 WP_007566773.1.59145 WP_007566773.1.61980 WP_007566773.1.64777 WP_007566773.1.64947 WP_007566773.1.70084 WP_007566773.1.86888 WP_007566773.1.89921 426355.Mrad2831_0713 gi|170747147|ref|YP_001753407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]