SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089PBC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089PBC1
Domain Number 1 Region: 12-357
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 2.75e-119
Family Bacterial photosystem II reaction centre, L and M subunits 0.0000000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A089PBC1
Sequence length 358
Comment (tr|A0A089PBC1|A0A089PBC1_9PROC) Photosystem Q(A) protein {ECO:0000256|HAMAP-Rule:MF_01383} KW=Complete proteome OX=1501268 OS=Prochlorococcus sp. MIT 0604. GN=EW14_1390 OC=Prochlorococcus.
Sequence
MTIAVGSAPQRGWFDVLDDWLKRDRFVFIGWSGLLLLPCAYLAIGGWFVGTTFVTSWYTH
GVASSYLEGCNFLTAAVSTPGDAMGHSLLFLWGPEAQGSFVRWLQLGGLWNFVALHGVFG
LIGFMLRQFEIAGLVGIRPYNALAFSAVIAVFTSIFLIYPLGQHSWFFAPSFGVAAIFRY
ILFIQGFHNITLNPFHMMGVAGILGGALLCAIHGATVQNTLYEDTSIYTDGKVQSSTFRA
FDPTQEEETYSMITANRFWSQIFGIAFSNKRFLHFLMLFVPVMGMWTSSIGIVGLALNLR
AYDFVSQEIRAAEDPEFETFYTKNILLNEGMRAWMSSVDQPHENFVFPEEVLPRGNAL
Download sequence
Identical sequences A0A089PBC1 A0A0A1ZAV2 A0A0A2B197 A0A1Q1ESC8 A2BS57 A2BXM0 A3PDZ7 B9P2W2 Q1PKP3 Q319Y0
146891.A9601_13341 167542.P9515_13241 167546.P9301_13491 74546.PMT9312_1256 WP_002807316.1.100652 WP_002807316.1.26171 WP_002807316.1.29415 WP_002807316.1.2955 WP_002807316.1.30112 WP_002807316.1.39572 WP_002807316.1.43709 WP_002807316.1.50075 WP_002807316.1.51421 WP_002807316.1.55884 WP_002807316.1.56588 WP_002807316.1.6215 WP_002807316.1.72917 WP_002807316.1.74777 WP_002807316.1.77012 WP_002807316.1.79548 WP_002807316.1.83733 WP_002807316.1.93000 WP_002807316.1.96020 gi|78779639|ref|YP_397751.1| gi|126696687|ref|YP_001091573.1| gi|123968867|ref|YP_001009725.1| MES00003361138 gi|123966557|ref|YP_001011638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]