SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089Q0Q9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089Q0Q9
Domain Number 1 Region: 7-104
Classification Level Classification E-value
Superfamily TrpR-like 2.67e-28
Family Trp repressor, TrpR 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A089Q0Q9
Sequence length 112
Comment (tr|A0A089Q0Q9|A0A089Q0Q9_9ENTR) Trp operon repressor {ECO:0000256|HAMAP-Rule:MF_00475, ECO:0000256|SAAS:SAAS00907407} KW=Complete proteome OX=158822 OS=Cedecea neteri. GN=JT31_09205 OC=Enterobacteriaceae; Cedecea.
Sequence
MTQLSQYSAEQAEQSNKEWLRFVGLLQQAFGQDLHMPLLTLLLTPDERTALGTRVRIIEE
LLRGELSQRELKNELGAGIATITRGSNSLKAAPTELREWLEKELLQGGKPTR
Download sequence
Identical sequences A0A089Q0Q9
WP_038475749.1.13882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]