SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089Q902 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089Q902
Domain Number 1 Region: 6-203
Classification Level Classification E-value
Superfamily ITPase-like 2.62e-63
Family ITPase (Ham1) 0.0000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A089Q902
Sequence length 209
Comment (tr|A0A089Q902|A0A089Q902_9RHIZ) Nucleoside-triphosphate pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01405} KW=Complete proteome OX=693986 OS=Methylobacterium oryzae CBMB20. GN=MOC_3309 OC=Methylobacteriaceae; Methylobacterium.
Sequence
MSRRLTGKVVIATHNAGKLTEMRELLAPFGVEAVSAGELGLPEPEETGTMFAENAAIKAK
AAADATGLPAFADDSGLCVDALDGAPGIFSARWAGPNKDFAAAMARIFAELDDRGAADRR
AHFVSALVLAWPDGHTELFEGRVFGDLVAARGTAGFGYDPIFRPDGHARTFGEMSAEEKH
GVDWQKGQGLSHRARAFVALSRACLASGS
Download sequence
Identical sequences A0A089Q902
WP_043758149.1.64947 WP_043758149.1.86888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]