SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A089YQP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A089YQP7
Domain Number 1 Region: 21-179
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 4.97e-53
Family N-acetylmuramoyl-L-alanine amidase-like 0.00000873
Further Details:      
 
Domain Number 2 Region: 183-255
Classification Level Classification E-value
Superfamily PGBD-like 9.02e-20
Family Peptidoglycan binding domain, PGBD 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A089YQP7
Sequence length 257
Comment (tr|A0A089YQP7|A0A089YQP7_9PSED) N-acetylmuramoyl-L-alanine amidase {ECO:0000313|EMBL:AIS18788.1} KW=Complete proteome; Reference proteome OX=216142 OS=Pseudomonas rhizosphaerae. GN=LT40_15935 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKLFLVALSLLVLAGCSNGLSIDRSYPSANQDNRVQFVVLHYTSADLPRSLQLLTHGEVS
SHYLIGDEPATVYQLVDESRRAWHAGQSQWDGRTWLNSSSIGIEIVNPGYKDTPSGRVWY
PYSEAQIQAVIALLKDIVQRNGIAPRNIIGHSDIAPLRKTDPGPMFPWQRLAEHGLGIWP
NAQAVARNQARFQVSPPSIAWYQQQLARLGYEVVQSGELDVATRHVIAAFQMHFRPQRFD
GEPDAQSAAILQALNSQ
Download sequence
Identical sequences A0A089YQP7
WP_043191911.1.40462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]