SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090JUF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090JUF5
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.07e-55
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A090JUF5
Sequence length 174
Comment (tr|A0A090JUF5|A0A090JUF5_METFO) Pyruvate synthase subunit PorC {ECO:0000313|EMBL:CEA13086.1} KW=Complete proteome OX=2162 OS=Methanobacterium formicicum. GN=DSM1535_0730 OC=Methanobacteriaceae; Methanobacterium.
Sequence
MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGAERKGAPVMAFSRINDKPIRR
RYQVYNPDHVLVLDETLLEAVDVLSGLKKGGKVIINTKEDLELSGADVHTIDATGIALET
LGVPIVNTVMLGAFAKVVGGVSLDSIIKITKETFPGPIGEKNAEAAKIAFEKVE
Download sequence
Identical sequences A0A090JUF5
WP_048072340.1.35295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]