SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090MM86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090MM86
Domain Number 1 Region: 26-111
Classification Level Classification E-value
Superfamily TrpR-like 5.23e-18
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090MM86
Sequence length 119
Comment (tr|A0A090MM86|A0A090MM86_AFIFE) Chromosomal replication initiation protein {ECO:0000313|EMBL:CEG08506.1} KW=Complete proteome OX=1035 OS=Afipia felis (Cat scratch disease bacillus). GN=BN961_01922 OC=Bradyrhizobiaceae; Afipia.
Sequence
MLPTPVSVSSSHSAAPSPDPETIRSRVAAYVIADFGITADELAFGSRGSPRASLARQVAM
YLCHVGFALSFEGIGRLFHCDRTTVAYACRVIEERREDVWFDSRIAALERVVARAECGR
Download sequence
Identical sequences A0A090MM86
WP_048756378.1.57528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]