SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090S755 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090S755
Domain Number 1 Region: 6-131
Classification Level Classification E-value
Superfamily DsrEFH-like 2.94e-38
Family DsrEF-like 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A090S755
Sequence length 131
Comment (tr|A0A090S755|A0A090S755_9VIBR) tRNA 5-methylaminomethyl-2-thiouridine synthase TusD {ECO:0000313|EMBL:GAL23520.1} KW=Complete proteome OX=990268 OS=Vibrio maritimus. GN=JCM19235_3082 OC=Vibrionaceae; Vibrio.
Sequence
MSALTYSLVVNGSVYGSQSARNAYQFANALIAKGHKLVSVFFYQDGVHNASRLTVPANDE
FDLVSAWQALSNEHGVRLETCVAASLRRGVLGSDEASQHQRDADNLASGFEQAGLGSLAS
AMLTQDRVVQF
Download sequence
Identical sequences A0A090S755 A0A090TEB4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]