SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090SBK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090SBK0
Domain Number 1 Region: 18-192
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 2.88e-65
Family N-acetylmuramoyl-L-alanine amidase-like 0.000000419
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090SBK0
Sequence length 193
Comment (tr|A0A090SBK0|A0A090SBK0_9VIBR) N-acetylmuramoyl-L-alanine amidase AmpD {ECO:0000313|EMBL:GAL23899.1} KW=Complete proteome; Reference proteome OX=990271 OS=Vibrio variabilis. GN=JCM19239_2882 OC=Vibrionaceae; Vibrio.
Sequence
MQNQDRPYSFQSFSEINEQGWYQAARRVVSPHFDARPDKEDVSLLVVHNISLPPAQFGGP
YIEDFFLGQLDASSHPFFKVIEKMKVSAHCLIRRDGEVVQFVPFSARAWHAGVSSFAGRA
RCNDYSIGIELEGTDYVSYTDAQYASLQRLTQSLMVRYPQITRERITGHQYIAPLRKSDP
GLVFDWSRFKNTL
Download sequence
Identical sequences A0A090SBK0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]