SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090T5V8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090T5V8
Domain Number 1 Region: 2-37
Classification Level Classification E-value
Superfamily XseB-like 0.000000000719
Family XseB-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A090T5V8
Sequence length 39
Comment (tr|A0A090T5V8|A0A090T5V8_9VIBR) Exodeoxyribonuclease 7 small subunit {ECO:0000256|SAAS:SAAS00387558} KW=Complete proteome; Reference proteome OX=990271 OS=Vibrio variabilis. GN=JCM19239_7442 OC=Vibrionaceae; Vibrio.
Sequence
MATKKPENMSFEATVDELDTLVEQLENGDLALDDALKKV
Download sequence
Identical sequences A0A090T5V8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]