SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090WZ29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090WZ29
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.76e-21
Family Ribosomal protein L11, C-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090WZ29
Sequence length 61
Comment (tr|A0A090WZ29|A0A090WZ29_9FLAO) LSU ribosomal protein L11p {ECO:0000313|EMBL:GAL72627.1} KW=Complete proteome OX=504487 OS=Jejuia pallidilutea. GN=JCM19302_3273 OC=Flavobacteriaceae; Jejuia.
Sequence
MKKGSGEPNRKKVAKVSWDQIKTIAEDKMQDLNAFTIESAMKMVAGTARSMGITVTGKFP
S
Download sequence
Identical sequences A0A090WZ29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]