SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A090X7L8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090X7L8
Domain Number 1 Region: 40-98
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000106
Family ATI-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090X7L8
Sequence length 99
Comment (tr|A0A090X7L8|A0A090X7L8_IXORI) Putative trypsin inhibitor like cysteine rich domain protein {ECO:0000313|EMBL:JAC92056.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MDARVSRCVLLAYLTMLATGYAAASGGSEGSDNDGENAILPCGQGEVFKECESSSCAELT
CASPEPTDECSRDCVFGCFCKDGLYRNTEKKCVSLENCS
Download sequence
Identical sequences A0A090X7L8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]