SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091BEK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091BEK9
Domain Number 1 Region: 540-709
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.84e-23
Family Methylesterase CheB, C-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091BEK9
Sequence length 711
Comment (tr|A0A091BEK9|A0A091BEK9_9GAMM) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=1121013 OS=Arenimonas composti TR7-09 = DSM 18010. GN=P873_11435 OC=Xanthomonadaceae; Arenimonas.
Sequence
MRVALLARPGDARDQLRRALADAGAELVAEGDPAELDPGAVAGGQPGIVVVSLEPAIEEA
LERFDELLHADAIEVIYDDAEVTRQLDGWDLARWARHLAAKLTGATEVLPPAPEGQELHV
PVAAPADADDAPALELPEVDPAAIQPGAPPTPAQEMDAEKLEDYAAESLELSDWVPSNPS
LAAEPVEAPLAEANAAAGEEPSLELDLDLDLAGLEQALTAGADAAAPTLASALEASGIDV
PQQLDADEVPLHLEDTAAGAPASAEAPTAEVPLGLEDADAPLELEAADAPLDFDGGDAPL
DLEADDTPLDFDAGDVPLDFDPAGEAPLDLETSDEAPLDFASADEPMAFDGMEDTPLDFT
ADAAESEGPAADGDLDLDLDSGVDVPVAAGDDAPLPELEIGDGPVRFSTFTEDEQGAPAE
PAMDDDVAALAAQLEAFEANDTREMPREPDFANIALDPSPTPAAAAGPGRGAPAAPAAPA
AGGSLFDNLELVPMDADLGKVTAADANTPPAPSLAAVAEKRTVLNLAGENETRNVQAVSG
ALFVVAGLGGPDGVRQLLAALPPTLPVPVLLYQHLDTGKHERLVTQLSKASKLPLDLAVA
GKMAFPGRVAVLQPGIGISVRGEHVEFTEGSEGLAAVVAALPAADSAVLVLSGADPAVMP
AALALGAAGGLLLAQDPETCFDPVAPQAAIAAGGSTGAIAELARRIIERWS
Download sequence
Identical sequences A0A091BEK9
WP_043797852.1.19743 WP_043797852.1.3990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]