SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091BGU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091BGU6
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily YcfC-like 1.06e-59
Family YcfC-like 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091BGU6
Sequence length 203
Comment (tr|A0A091BGU6|A0A091BGU6_9GAMM) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695, ECO:0000256|SAAS:SAAS00958394} KW=Complete proteome; Reference proteome OX=1384054 OS=Arenimonas malthae CC-JY-1. GN=N790_01185 OC=Xanthomonadaceae; Arenimonas.
Sequence
MKERALALAGLLQAVYLVQQMAQNGQAQAGPLAASIDSLFRFDAESPEAVFDGAGNLRLG
LERLVNQFEGGAGRDAAVTRMAMTVLHLERKFIRHGRAPGAVHDGLKEIARQREHWGPAH
PTVLARLGELYAREVSPIGPRVLVQGNPVYLGQPDVVGEVRATLLAAVRAAVLWRQLGGS
YWDFLFGRRALVQAARDWLDATR
Download sequence
Identical sequences A0A091BGU6
WP_043801776.1.15901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]