SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091CU82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091CU82
Domain Number 1 Region: 399-597
Classification Level Classification E-value
Superfamily MIR domain 3.84e-70
Family MIR domain 0.00000000269
Further Details:      
 
Domain Number 2 Region: 599-764
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.89e-60
Family IP3 receptor type 1 binding core, domain 2 0.0000000192
Further Details:      
 
Domain Number 3 Region: 1261-1417
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 4.18e-37
Family IP3 receptor type 1 binding core, domain 2 0.0065
Further Details:      
 
Domain Number 4 Region: 298-396
Classification Level Classification E-value
Superfamily MIR domain 1.31e-18
Family MIR domain 0.015
Further Details:      
 
Domain Number 5 Region: 2-51
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000765
Family Thioltransferase 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091CU82
Sequence length 2857
Comment (tr|A0A091CU82|A0A091CU82_FUKDA) Inositol 1,4,5-trisphosphate receptor type 1 {ECO:0000313|EMBL:KFO21553.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_17057 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MTKPFFHSLSKKYSNMLFLEVDVGACLDLAAEFEVKCMPAFQFFRKGAKMVFPSRPGLQG
DTLCRKQEQAKVHAAAPAPARPGTWTTLPRELPGLYKLPPATSKCSNHVDVLLKCFLKLA
GVGGEEEEEEVVVVVEEEEAGGGERKRTPRGGIFLSKYSGAEDKGAGFAFLAGQTLAIEC
LTRVRIFEKDMSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPP
KKFRDCLFKLCPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKL
LGTVIQYGNVIQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLR
SIGDSVVIGDKVVLNPVNAGQPLHASSHQLVDNPGCNEGDVVRLFHAEQEKFLTCDEHRK
KQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWNSLFRFKHLATGHYLAAEV
DPEFEEECLEYQPSVDPDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTLRGG
DSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGTSPVKEDKEAFAIVPVSPA
EVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVLEVV
FSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRLCYR
VLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEIDTF
VSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPTNADILIETKLVLSRFEFE
GVSSGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAKEGQKEDRDVLSYYRQVGG
HVELGLRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASFCRLMLH
MHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEFVEEYLRDV
VCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVTTIFPIS
KMAKGEENKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAPEGNVKQV
EPEKEDIMVMDTKLKIIEILQVLLILNTLKNKLKASLEEGNEENTPLDLDDHGGRTFLRV
LLHLTMHDYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLR
SIVEKSELWVYKGQGPDEIMDGASGENEHKKTEEGNNKSQKHESTSSYNYRVVKEILIRL
SKLCVQESASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQN
FCAGNQQNQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHG
RNVQYIKFLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERD
RMDENSPLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYI
NFLNHCYVDTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVM
SIVTTFFSSPFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVA
KSRAIAIPVDLDSQVNNLFLKSHNIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERL
QDIVSALEDRLRPLVQAELSVLVDVLHRPELLFPENTDARKKCESGGFICKLIKHTKQLL
EENEEKLCIKVLQTLREMMTKDRGYGEKLPQALEPENSTEGEALRQILVNRYYGNVRPSG
RRESLTSFGNGPLSPGGPSKPGGGGGGSGSSSTSRGEMSLAEVQCHLDKEGASNLVIDLI
MNATSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMKLAQQEIK
ATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPSTQITEEVRDQLLEASTATRKAFTTFRR
EADPDDHYQPGEGTQATTDKTKDDLEMSAVITIMQPILRFLQLLCENHNRDLQNFLRCQN
NKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQGPCHENQ
NCIATHESNGIDIITALILNDINPLGKKRMDLVLELKAICASKHMCLFDPDQNNASKLLL
AIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNVGHNIY
ILAHQLARHNKELQTMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICE
FLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWS
SISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALI
ASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMILDVEFLYHLL
YLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSI
VGYLFFKDDFILEVDRLPNETAVPETGESLASEFLYSDVCRVESGENCSSPTPKEELVPV
EEMEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMV
IIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHN
MWHYLCFIVLVKVKDSTEYTGPESYVAEMIKNLGVRHALREKHMLAKEVRREEEQPILLT
STKKVHRCELVTSSKDRDMGGNRMGLPYTNGQHPSAI
Download sequence
Identical sequences A0A091CU82

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]