SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091DH65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091DH65
Domain Number 1 Region: 216-368
Classification Level Classification E-value
Superfamily MIR domain 4.58e-37
Family MIR domain 0.0072
Further Details:      
 
Domain Number 2 Region: 1055-1182
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.96e-18
Family SPRY domain 0.041
Further Details:      
 
Domain Number 3 Region: 633-785
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000174
Family SPRY domain 0.046
Further Details:      
 
Domain Number 4 Region: 102-186
Classification Level Classification E-value
Superfamily MIR domain 0.00000314
Family MIR domain 0.02
Further Details:      
 
Domain Number 5 Region: 416-526
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000103
Family IP3 receptor type 1 binding core, domain 2 0.013
Further Details:      
 
Domain Number 6 Region: 2174-2244
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000114
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 7 Region: 3965-4043
Classification Level Classification E-value
Superfamily EF-hand 0.0000143
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 8 Region: 1408-1532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000237
Family SPRY domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091DH65
Sequence length 4775
Comment (tr|A0A091DH65|A0A091DH65_FUKDA) Ryanodine receptor 1 {ECO:0000313|EMBL:KFO29610.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_08983 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MGDGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPP
DLAICCFILEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSGMYLSC
LTTSRSMTDKLAFDVGLQEDATGEACWWTTHPASKQRSEGEKVRVGDDLILVSVSSERYL
HLSTASGELQVDASFMQTLWNMNPICSCCEEGYVTGGHVLRLFHGHMDECLTISPADSDD
QRSWSGSHLRWGQPLRIRHVTTGRYLALTEDQGLVVVDASKAHTKATSFCFRISKEKLDV
APKRDVEGMGPPEIKYGESLCFVQHMASGLWLTYAAPDPKALRLGVLKKKAMLHQEGHMD
DALSLTRCQQEESQAARMIHSTAGLYNQFIRGLDSFSGKPRGSGPPAGSALPIEGVILSL
QDLIGYFEPPSEELQHEEKQSKLRSLRNRQSLFQEEGMLTLVLNCIDRLNVYTTAAHFAE
FAGEEAAESWKEIVNLLYELLASLIRGNRTNCALFSTNLDWLVSKLDRLEASSGILEVLY
CVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSLCVCNGVAVRSNQDLITENL
LPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYGKWYFEVMVDEVAPFLTAQATHLRVG
WALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWTGHVARPVTSPAQHLLAPEDVIS
CCLDLSVPSISFRINGCPVQGVFEAFNLDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPP
PGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHLVGPSRCLSHTDFVPCPVDTVQIVLPP
HLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPCLVDFHSLPEPERNYNLQMS
GETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYKPAPLDLSHVRLTPAQTTLV
DRLAENGHNVWARDRVGQGWSYSAVQDIPARRNPRLVPYRLLDEATKRSNRDSLCQAVRT
LLGYGYNIEPPDQEPSQVERQSRWDRVRIFRAEKSYAVQSGRWYFEFEAVTTGEMRVGWA
RPELRPDIELGADDLAYVFNGHRGQRWHLGSEPFGRPWQSGDVVGCMIDLTESTIIFTLN
GEVLMSDSGSETAFREIEIGDGFLPVCSLGPGQVGHLNLGQDVSSLRFFAICGLQEGFEP
FAINMQRPVTTWFSKSLPQFEPVPLDHPHYEVSRMDGTVDTPPCLRLTHRTWGSQNSLVE
MLFLRLSLPVQFYLHFRCTAGATPLAPPGLQPPAEDEARAAEPDPDYENLRRSAGGWGEA
EGGKEGMAKEGAPGGLPQAGVEAQPARAENEKDATTEKNKKRGFLFKAKKAAMMTQPPAT
PTLPRLPRDVVPTDNRDDPEIILNTTTYYYSVRVFAGQEPSCVWVGWVTPDYHQHDMNFD
LSKVRAVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHMDLVIGCLVDLATG
LMTFTANGKESNTFFQVEPNTKLFPAVFVLPTNQNVIQFELGKQKNIMPLSAAMFMSERK
NPAPQCPPRLEVQMLMPVSWSRMPNHFLQVDTRRAGERLGWALQCQEPLTMMALHIPEEN
RCMDILELSERLDLQRFHSHTLSLYRAVCALGNNRVAHALCSHVDQAQLLHALEDAHLPG
PLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTSETRAITLFPPRPTSEDGSRRHGLPG
VGVTTSLRPPHHFSPPCFVMALPVAGAAEAPARLSPAIPLEALRDKALRMLGEAVRDGGQ
HARDPVGGSVEFQFVPVLKLVSTLLVMGVFGDEDVKQILKMIEPEVFKEEEEEEVEEEEG
EEEEEEDEEEKEEDEEEGTHEKDDEEKEEEEAAEGEKEDLEEGLLQMKLPESVKLQMCHL
LEYFCDQDLQHRVESLAAFAERYVDKLQSNQRDRYGLLMKAFTMSAAETARRTREFRSPP
QEQINMLLQFKDDADEEDCPLPDDIKQDLQDFHQDLLTHCGIQLEGEEEEAEEETTLGSR
LMSLLEKVRLVKKKEEKPEEEPPAEEPKLHSLQELVSHMVVRWAQEDFVQSPELVRAMFS
LLHRQYDGLGELLRALPRAYTISLSSVKDTMSLLECLGQIRSLLIVQMGPQEENLMIQSI
GNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTSCCRFLCYFCRI
SRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQEQDLEKVVSYL
AGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENANVVVRLLIRKPE
CFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRRDRRREHFGEEAPEENRVHLGHAI
MSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLDDLVGIISLPLQIPTLGKD
GALVQPKMSASFVPDHKASMVLFLDRVYGIENQDFLLHVLDVGFLPDMRAAASLDTATFS
TTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTIYRLSRGRSLTKAQRDV
IEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWKYYCLPTGWA
NFGVTSEEELHLTRKLFWGIFDSLAHKKYDQELYRMAMPCLCAIAGALPPDYVDASYSSK
AEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKWAFDKIQNNWSYGENID
EELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTVEKAREGEEEKTEKKKTRKI
SQSAQTYDPREGYNPQPPDLSGVTLSRELQAMAEQLAENYHNTWGRKKKQELEAKGGGSH
PLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRQVSQAPREGFGKGLKDMELDTSS
IEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYF
TNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLHI
LARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVGQNLT
YTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNPYVEKLRPAL
GECLSRLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMCPDIPVLERLM
ADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEAPPPALPGRAPPPCTAVTSD
HLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLRSHFIPTIGRLRKRAG
KVVAEEEQLRLEAKAEAEEGEVLVRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTEPNPN
AEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKSGGSDQERTK
KKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQELITLAKARYALKDTDEEVREFLQN
NLNLQGKVEGSPSLRWQMALYWGVPGREEDADNPEKIVRRVQEVSAVLYHLDQTEHPFKS
KKAVWHKLLSKQRRRAVVACFRMTPLYNLPTKLDEDYLYIAYADIMAKSCHLEEGGENGE
VQEEEGEVSFEEKEMEKQRLLYQQSRLHIRGAAEMVLQMISACKGETGTMVSSTLKLGIS
ILNGGNTDVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKAEGLGMVNEDG
TGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQES
ISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAV
VGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEGNVVNGTIARQMVDMLV
ESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDFQKAMDSQKQFSGPEIQ
FLLSCSEADENEMINCEEFANRFQEPARDIGFNVAVLLTNLSEHVPHDPRLRNFLELAES
ILDYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKESKRQFIFDVVNEGGEAE
KMELFGPVAVAEGSPFRPEGAGGLGDMGDTTPVEPPTPEGSPILKRKLGVDGEEEELPPE
PEPEPEPEPEKADAENGEKEEVPESPPEPPKKTAPPPPPPKKEEAGGAGVEFWGELEVQR
VKFLNYLSRNFYTLRFLALFLAFAINFILLFYKMSECLQEQELKLCSWPTSYTYQPYAQV
SDSPPGEDDMEGSAAGDMSGAGSGGGSGWGSGAGEEAEGDEDDSMVYYFLEESTGYMEPA
LRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQWD
RLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLATLEITAHNERKPNPPP
GLLTWLMSIDIKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDIAMGVKT
LRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTC
YLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFGE
LRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETE
HTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences A0A091DH65

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]