SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091EE26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091EE26
Domain Number 1 Region: 9-110
Classification Level Classification E-value
Superfamily Virus ectodomain 2.56e-24
Family Virus ectodomain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091EE26
Sequence length 154
Comment (tr|A0A091EE26|A0A091EE26_CORBR) Uncharacterized protein {ECO:0000313|EMBL:KFO55391.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_14671 OC=Corvus.
Sequence
LNEKCDPTVTFWNTAEHISASLVPIIGTAHTLASLNKLGFWLAKEANATSAALSAMLMDV
KSVRHATLKNRAAIDFLLLAQGHGCEDFDGMCCMNLSDHSESIHKSISNLKQLFKQLQQH
NEGDWWGVSSWLNNLGFGFGAWFKHLAMYGIVIL
Download sequence
Identical sequences A0A091EE26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]