SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091F903 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091F903
Domain Number 1 Region: 182-379
Classification Level Classification E-value
Superfamily MIR domain 7.76e-62
Family MIR domain 0.0000000732
Further Details:      
 
Domain Number 2 Region: 381-546
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 2.35e-56
Family IP3 receptor type 1 binding core, domain 2 0.00000023
Further Details:      
 
Domain Number 3 Region: 1082-1201
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.1e-31
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 52-165
Classification Level Classification E-value
Superfamily MIR domain 5.49e-21
Family MIR domain 0.017
Further Details:      
 
Domain Number 5 Region: 1100-1285,1339-1608,1878-2058
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000864
Family Plakophilin 1 helical region 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091F903
Sequence length 2663
Comment (tr|A0A091F903|A0A091F903_CORBR) Inositol 1,4,5-trisphosphate receptor type 2 {ECO:0000313|EMBL:KFO65716.1} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_05177 OC=Corvus.
Sequence
DCLFKVCPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENRKLLGEI
VKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIQPFWKLRSEGD
NVVVGDKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKFSSYRDDVL
KGGDVVRLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRG
GAGQWNSLFRFKHLATGNYLAAEVRMPTEQVFVCCLTKDGDLPASKKKRQAGEKIMYTLV
SVPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTEEERPVML
KIGTCQTKEDKEAFAIVSVPLSEVRDLDFANDANKVLASTVKKLENGTITQNERRFVTKL
LEDLIFFVADVPNNGQEVLDVIITKPNRERQKLMREQNILAQIFGILKAPFKDKGEGSML
RLEDLGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTIT
ALLHNNRKLLEKHITAKEIETFVNLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFM
LSPGNADILIQTKLVSTQMDNPLECPVISDDIDEEEVWLYWIDSNKEPHGKAIRHLAQEA
KEGTKADLEVLTYYRSLWCLSSTPDCGLKFLPRSQFMSELRVFQTKVQKLFVGLVSEQSS
CKCPMSTKQVFNFPSFCALYCRYDSFTDSSRNEMKTKFALTMEFVEEYLKEVVNQPFPFG
DKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQVPISSYFERLSKFQDG
GNNVMRTIHGVGEMMTQMVLSRGSVFPISTPDIQPSIHPSKQASTADSEDVIVMDTKLKI
IEILQFILSVRLDYRISYMLSIYKREFGENTENVDCSTSSPPDTPGTASAIVPDIDEIAA
QAETMFAGRKEKNAVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALHLLFKHFSQRAEVLQ
AFKQVWMDWVLSQETECSEPVQRLLCYLNCRLLHDCVLSIEAQYQQTSLAICAGESNILS
PIQDGTKKPQIDSIKSNNYNIVKEILIRLSKLCVQNKKCRNQQQRLLKNMGAHLVVLDLL
QIPYEKSDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKNLNLFLTPGLLEAETMRHIFMN
NYLLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADGKYVKKCQDMVMTELINGGE
DVLIFYNDRASFPVLLQMMCSERDRADESGPLAYHVTLVELLAACTEGKNVYTEIKCNSL
LPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKEIYASNHIWKLFENFLVDMAR
VCNTTTDRKHADTSLEKYVTEPVMNIVSGFFNSPFSDNSTSLQTHQPVFIQLLQSAFRIY
NCTWPNPTQKASVESCIKTLAEVAKNRGIAIPVDLDSQVNTLFMKSHSNMVQRAAMGWRM
SARSGPRFKEALGGPAWDYRNIIEKLQDVVSSLEQQFTPMMQAEFSVLVDVLHSPELLFP
EGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREMLDKKTNFAEENNNNRNYTP
TNIICCAFASHLLFKQRKLATTLISPIFIFLLKGNTLRKILLYRYFKGEYGSGMNGPLSA
SYSKTAQVGGGFSGQDADKSGVTMFDIQCLLDKEGASELVIDVIVNTRNDRIFSEGILLG
IALLEGGNTQTQYSTYQQLKEQKKSERFFKVLYDHMKAAQQEIRSTVTVNTIDLGSKKKE
DDSDLTISVPKKRVKDSTLHLKEGMKGQLTEASSATSKAYSVYRREMDPEIDLMGSGTDA
ANAEEKSAEEAVMSPAIAIMQPILRFLQLLCENHNRELQNFLRHQNNKTNYNLVCETLQF
LDCICGSTTGGLGLLGLYINERNVALVNQTLESLTEYCQGPCHENQTCIATHESNGIDII
IALILNDINPLGKYCMDLVLQLKNNASKLLLAIMESRQDSENAERILFNMRPRELVDVMK
NAYNQGLECDHEEENGDDGISPKDVGHNIYILAHQLACHNKALQQMLKPGSDPDEGDEAL
RFYAKHTAQIEIVRHDRTMEKIVFPVPNICEFLTRESKSRVFNTTERDEQGSKVNDFFQQ
TEDLYNEMKWQKKIRNNPALFWFSRHISLWGNISFNLAVFINLAVALFYPFGDDGDEGKY
STLSPLFSVLLWIAVAFCTAMLFFISKPVGIRPFLVSVILRSIYTIGLGPTLILLGAANL
CNKIVFLVSFVGNRGTFTRGYRAVIMDMAFLYHVAYVLVCMLGLCVHEFFYSFLLFDLVY
REETLLNVIKSVTRNGRSIILTAVLALILVYLFSIIGFLFLKDDFIMEVDRLKIRTPAAG
IGEVPTTTLTSMMGACAKENCSTSIPPLNPGEEEEDGIERTCDTLLMCIVTVLNQGLRNG
GGVGDVLRKPSKDEPLFAARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEI
LKTTCFICGLERDKFDNKTVSFEEHIKAEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQM
IVERNLDWFPRMRAMSLVSNEGESEQNEIRNLQERLESTMSLVKQLSSQLAELKEQMTEQ
RKNKQRLGFLGSNTPHVNHHMPP
Download sequence
Identical sequences A0A091F903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]