SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091FH66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091FH66
Domain Number 1 Region: 137-256
Classification Level Classification E-value
Superfamily EF-hand 1.94e-34
Family Osteonectin 0.023
Further Details:      
 
Domain Number 2 Region: 225-320
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.19e-28
Family Thyroglobulin type-1 domain 0.00082
Further Details:      
 
Domain Number 3 Region: 73-121
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000388
Family Ovomucoid domain III-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091FH66
Sequence length 379
Comment (tr|A0A091FH66|A0A091FH66_9AVES) Testican-1 {ECO:0000313|EMBL:KFO69915.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_03177 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
DDYFRNWNPNKPFDQALDPSKDPCLKVKCSPHKVCVTHDYETAICVSRKQLVHSLRQKKG
NLAQKHWTGPANIVKCKPCPLTHASAVCGSDGHTYTTKCKLEFHACTSGKSITARCEGPC
PCLPGPESLKHKTEKTACTDKELRNLASRLKDWFGALHEDANRVIKPTSSETAQGRFDTS
ILPICKDSLGWMFNKLDMNYDLLLDPSEISAIYLDKYEPCVKPLFNSCDSFKDGKLSNNE
WCYCFQKPGGLPCQNEMNRIQKLSRGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDK
YGNEIAGSRKQGTVSCEEEQETSGDFGSGGSVVLLDDLEEEPEAAKKDKDGKLKIHVRAA
NEDDEDEDDDKDDEIGYIW
Download sequence
Identical sequences A0A091FH66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]