SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091FU41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091FU41
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-46
Family Calponin-homology domain, CH-domain 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091FU41
Sequence length 254
Comment (tr|A0A091FU41|A0A091FU41_CORBR) Calponin {ECO:0000256|RuleBase:RU361224} KW=Complete proteome; Reference proteome OX=85066 OS=Corvus brachyrhynchos (American crow). GN=N302_05641 OC=Corvus.
Sequence
QLAQKYDPQKEAELRTWIESVTGKQIGPDFQKGLKDGVILCELMNKLQPNSVRKINRSAQ
NWHQLENLSNFIKAMASYGMNPVDLFEANDLFESGNLTQVQVSLLALAGMAKTKGLQSGV
DIGVKYSEKQQRNFDEAKMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNQILPP
MDHSTISLQMGTNKCASQVGMTAPGTRRHIYDAKMGTEKCDNSSMSLQMGSNQGANQSGQ
VFGLGRQIYDPKYC
Download sequence
Identical sequences A0A091FU41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]