SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091G0J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091G0J1
Domain Number 1 Region: 33-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000119
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number 2 Region: 83-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000432
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091G0J1
Sequence length 160
Comment (tr|A0A091G0J1|A0A091G0J1_9AVES) Low-density lipoprotein receptor class A domain-containing protein 1 {ECO:0000313|EMBL:KFO76000.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_09816 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
SAAALLLLATTVGLAVALGLLSHTPVNRFCTAFNNQTGFLCDDSVTCILASQVCDGLRNC
RNREDEQEELCGDLPNSLPGYLVFRCSNPAYWIYADQRCNRMNDCGDCSDEMGSLAACPP
CGLEWWSCSPVLYEYCSCIPRRLCRDGIQHCLSWSDEYIC
Download sequence
Identical sequences A0A091G0J1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]