SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GMF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GMF7
Domain Number 1 Region: 2-270
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-120
Family BEACH domain 0.0000000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091GMF7
Sequence length 270
Comment (tr|A0A091GMF7|A0A091GMF7_BUCRH) WD repeat and FYVE domain-containing protein 3 {ECO:0000313|EMBL:KFO84379.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_09550 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
KRGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEELDLTNPKTFRNLAKPMGA
QTEDRLAQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHF
DLADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLLNSNNFDLGCKQNGTKLGDVI
LPPWAKGDPREFIRVHREALECDFVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEG
QVDIYNINDPLKETATIGFINNFGQIPKQV
Download sequence
Identical sequences A0A091GMF7 A0A091RSX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]