SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GN75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GN75
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily PH domain-like 8.28e-44
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000144
Further Details:      
 
Domain Number 2 Region: 474-512
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00000000000262
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0017
Further Details:      
 
Domain Number 3 Region: 293-308
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000141
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 
Domain Number 4 Region: 254-325
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000837
Family beta-sandwich domain of Sec23/24 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091GN75
Sequence length 514
Comment (tr|A0A091GN75|A0A091GN75_9AVES) Protein enabled {ECO:0000313|EMBL:KFO82649.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_13812 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
SEQSICQARAAVMVYDDANKKWVPAGGSAGFSRVHIYHHTGNNTFRVVGRKIQDHQVVIN
CAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQEAGPTLP
RQNSQLPSQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERERL
ERERLEQEQLERERQERERQERLERERQEKERQDRERLERLERERQERERQEQLEREQLE
WERERRISNAGVVQGPPAPPPPPPLPPGPAQSSVAAPPPPGPPPPPPLPAAGPPPPPPPP
PPPLPSQAPPVPLPPPAPPLPASGFSVGFVSEENRPLTGLAAALAGAKLRKVSRGEDSSS
TSGGGGSSASSKTDGGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTEPEQKEDKTEE
SESSTSKVSSTSTPELTRKPWERTNTVNGSKSPVISRPKSTSTGQPSANGVQLEGLDYDR
LKQDILDEMRKELTKLKEELIDAIRQELSKSNTA
Download sequence
Identical sequences A0A091GN75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]