SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A091H893 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091H893
Domain Number 1 Region: 294-489
Classification Level Classification E-value
Superfamily MIR domain 8.89e-49
Family MIR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091H893
Sequence length 728
Comment (tr|A0A091H893|A0A091H893_9AVES) Protein O-mannosyl-transferase 1 {ECO:0000313|EMBL:KFO82482.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_06142 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
MLGFLKKPLVVTVEINMNLVALTVMGLISRLWRLSYPRAVVFDEVYYGQFVSLYMKRIFF
VDDSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSMNVPVWSLRLLPALAGALCVPLAY
QILVELQFSHCTALGAALLILLENSLITQSRFMLLESILIFFILLAVLSYLKFYNLQRHS
SFSGSWWFWLFLTGVACSCAVGVKYMGLFTYILLLTIAGLHFWHMIGDQNLSNVALLCHF
LARGLGLVVMPVAMYLSFFYVHLILLYRSGPHDQIMTSAFQASLEGGLARITQGQPLEVA
YGSQITLRNVLGKPMQCWLHSHTNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
MQQLVVSNPPRPVRHGHIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRVEIVNRESDTDVWKTILSEVRFVHVNTSAVLKASGFLGASLPEWGYRQLEVVGEKLS
KGYHQSMVWNVEEHRYGKSQEQKEREVELHSPTQMDISKNLSFMAKFTELQWKILTLKNE
DTEHKYSSSALDWITMDTNIAYWLHPTSGAQIHLLGNVVTWASANIAALVYTCLSLWYLI
RRRRKIYDIPEDAWRLWVSAGGICIGGWAVNYLPFFLMEKTLFLYHYLPALTFQVLLIPI
VLQHLGNHLCRSLLLKSMFGALIVAWFSSVYLVYCTFSPVTYGEPSLSATELKDLRWKDS
WNILIRKQ
Download sequence
Identical sequences A0A091H893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]