SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HND6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HND6
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.1e-31
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091HND6
Sequence length 148
Comment (tr|A0A091HND6|A0A091HND6_CALAN) Pleckstrin homology domain-containing family G member 3 {ECO:0000313|EMBL:KFO97783.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_10692 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
GNIEDIYELSSTLLQNLESCASDPVAVAVCFVTRVRMGTLGGHTGCDRSLPSSVAALSEC
MRSKAQARFLRQCQEGLRHSLPLGAYLLKPVQRVLKYHLLLQEISKHFEHKSGEDYEVVL
EAIDTMTCVAWCINDMKRKHEHAIRQQV
Download sequence
Identical sequences A0A091HND6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]